Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	23582
Gene name	Cyclin D1 binding protein 1
Gene symbol	CCNDBP1
Synonyms (NCBI Gene)	DIP1GCIPHHM
Chromosome	15
Chromosome location	15q15.2
Summary	This gene was identified by the interaction of its gene product with Grap2, a leukocyte-specific adaptor protein important for immune cell signaling. The protein encoded by this gene was shown to interact with cyclin D. Transfection of this gene in cells

Show/Hide all (59)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021474	hsa-miR-9-5p	Microarray	17612493
MIRT030350	hsa-miR-26b-5p	Microarray	19088304
MIRT052851	hsa-miR-3615	CLASH	23622248
MIRT871778	hsa-miR-1289	CLIP-seq
MIRT871779	hsa-miR-3198	CLIP-seq
MIRT871780	hsa-miR-4294	CLIP-seq
MIRT871781	hsa-miR-4309	CLIP-seq
MIRT871782	hsa-miR-4426	CLIP-seq
MIRT871783	hsa-miR-4647	CLIP-seq
MIRT871784	hsa-miR-4662b	CLIP-seq
MIRT871785	hsa-miR-1179	CLIP-seq
MIRT871778	hsa-miR-1289	CLIP-seq
MIRT871786	hsa-miR-31	CLIP-seq
MIRT871787	hsa-miR-3128	CLIP-seq
MIRT871779	hsa-miR-3198	CLIP-seq
MIRT871788	hsa-miR-34b	CLIP-seq
MIRT871789	hsa-miR-3672	CLIP-seq
MIRT871780	hsa-miR-4294	CLIP-seq
MIRT871781	hsa-miR-4309	CLIP-seq
MIRT871782	hsa-miR-4426	CLIP-seq
MIRT871790	hsa-miR-4461	CLIP-seq
MIRT871783	hsa-miR-4647	CLIP-seq
MIRT871784	hsa-miR-4662b	CLIP-seq
MIRT871791	hsa-miR-4729	CLIP-seq
MIRT871792	hsa-miR-4786-5p	CLIP-seq
MIRT871793	hsa-miR-570	CLIP-seq
MIRT871794	hsa-miR-769-5p	CLIP-seq
MIRT1958730	hsa-miR-124	CLIP-seq
MIRT1958731	hsa-miR-3622a-5p	CLIP-seq
MIRT1958732	hsa-miR-3714	CLIP-seq
MIRT1958733	hsa-miR-3910	CLIP-seq
MIRT1958734	hsa-miR-4423-3p	CLIP-seq
MIRT1958735	hsa-miR-506	CLIP-seq
MIRT2498907	hsa-miR-299-5p	CLIP-seq
MIRT2498908	hsa-miR-3121-3p	CLIP-seq
MIRT2498909	hsa-miR-340	CLIP-seq
MIRT2498910	hsa-miR-3664-3p	CLIP-seq
MIRT2498911	hsa-miR-510	CLIP-seq
MIRT2498912	hsa-miR-539	CLIP-seq
MIRT2498913	hsa-miR-584	CLIP-seq
MIRT2498914	hsa-miR-873	CLIP-seq
MIRT2498915	hsa-miR-944	CLIP-seq
MIRT1958730	hsa-miR-124	CLIP-seq
MIRT2677540	hsa-miR-217	CLIP-seq
MIRT2677541	hsa-miR-3123	CLIP-seq
MIRT2498910	hsa-miR-3664-3p	CLIP-seq
MIRT1958732	hsa-miR-3714	CLIP-seq
MIRT1958733	hsa-miR-3910	CLIP-seq
MIRT2677542	hsa-miR-4311	CLIP-seq
MIRT2677543	hsa-miR-4418	CLIP-seq
MIRT871792	hsa-miR-4786-5p	CLIP-seq
MIRT1958735	hsa-miR-506	CLIP-seq
MIRT2677544	hsa-miR-509-3-5p	CLIP-seq
MIRT2677545	hsa-miR-509-5p	CLIP-seq
MIRT2498911	hsa-miR-510	CLIP-seq
MIRT2498912	hsa-miR-539	CLIP-seq
MIRT871793	hsa-miR-570	CLIP-seq
MIRT871794	hsa-miR-769-5p	CLIP-seq
MIRT2498914	hsa-miR-873	CLIP-seq

Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	10915743, 15887118, 16189514, 19060904, 20460530, 21516116, 22453338, 25416956, 25910212, 26871637, 27107012, 28514442, 31515488, 32296183, 33961781, 36217029
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	12437976
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0016604	Component	Nuclear body	IDA

MIM	HGNC	e!Ensembl
607089	1587	ENSG00000166946

O95273

Protein name

Cyclin-D1-binding protein 1 (Grap2 and cyclin-D-interacting protein) (Human homolog of Maid)

Protein function

May negatively regulate cell cycle progression. May act at least in part via inhibition of the cyclin-D1/CDK4 complex, thereby preventing phosphorylation of RB1 and blocking E2F-dependent transcription.

PDB

3AY5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13324	GCIP	55 → 320		Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed. Expression is down-regulated in a variety of tumor types including breast, colon, prostate and rectal tumors, and is up-regulated in certain hepatic carcinomas. {ECO:0000269|PubMed:10801854, ECO:0000269|PubMed:1

Sequence

MASATAPAAAVPTLASPLEQLRHLAEELRLLLPRVRVGEAQETTEEFNREMFWRRLNEAA
VTVSREATTLTIVFSQLPLPSPQETQKFCEQVHAAIKAFIAVYYLLPKDQGITLRKLVRG
ATLDIVDGMAQLMEVLSVTPTQSPENNDLISYNSVWVACQQMPQIPRDNKAAALLMLTKN
VDFVKDAHEEMEQAVEECDPYSGLLNDTEENNSDNHNHEDDVLGFPSNQDLYWSEDDQEL
IIPCLALVRASKACLKKIRMLVAENGKKDQVAQLDDIVDISDEISPSVDDLALSIYPPMC
HLTVRINSAKLVSVLKKALEITKASHVTPQPEDSWIPLLINAIDHCMNRIKELTQSELEL

Sequence length

360

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LIVER NEOPLASMS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (16)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinogenesis	Carcinogenesis	Pubtator	39955062	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	17131381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	17131381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	BEFREE	2854715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	15887118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	16501603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37058478	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	17131381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	17131381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16501603, 17131381, 20460530, 26107195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	26107195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	26107195	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	20460530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	2172279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	26083618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Wiskott-Aldrich Syndrome	Wiskott-Aldrich Syndrome	BEFREE	31564494		★★★★★ ★☆☆☆☆ Found in Text Mining only

CCNDBP1 (cyclin D1 binding protein 1)