FPR2 (formyl peptide receptor 2)

Gene

• Entrez ID: 2358
• Gene name: Formyl peptide receptor 2
• Gene symbol: FPR2
• Synonyms (NCBI Gene): ALX, ALXR, FMLP-R-II, FMLPX, FPR2A, FPRH1, FPRH2, FPRL1, HM63, LXA4R
• Chromosome: 19
• Chromosome location: 19q13.41

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT619736	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT619735	hsa-miR-764	HITS-CLIP	23824327
MIRT619734	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT619733	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT619732	hsa-miR-1248	HITS-CLIP	23824327
MIRT619731	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT619730	hsa-miR-373-5p	HITS-CLIP	23824327
MIRT619729	hsa-miR-616-5p	HITS-CLIP	23824327
MIRT619728	hsa-miR-371a-5p	HITS-CLIP	23824327
MIRT619727	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT619725	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT619724	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT446577	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT619723	hsa-miR-640	HITS-CLIP	23824327
MIRT619722	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT619736	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT619735	hsa-miR-764	HITS-CLIP	23824327
MIRT619734	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT619733	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT619732	hsa-miR-1248	HITS-CLIP	23824327
MIRT619726	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT619725	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT619724	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT446577	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT619723	hsa-miR-640	HITS-CLIP	23824327
MIRT619722	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT619736	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT619735	hsa-miR-764	HITS-CLIP	23824327
MIRT619734	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT619733	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT619732	hsa-miR-1248	HITS-CLIP	23824327
MIRT619723	hsa-miR-640	HITS-CLIP	23824327
MIRT619722	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT619736	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT619735	hsa-miR-764	HITS-CLIP	23824327
MIRT619734	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT619733	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT619732	hsa-miR-1248	HITS-CLIP	23824327
MIRT619726	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT619725	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT619724	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT446577	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT619723	hsa-miR-640	HITS-CLIP	23824327
MIRT619722	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT619736	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT619735	hsa-miR-764	HITS-CLIP	23824327
MIRT619734	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT619733	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT619732	hsa-miR-1248	HITS-CLIP	23824327
MIRT619726	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT619725	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT619724	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT446577	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT619723	hsa-miR-640	HITS-CLIP	23824327
MIRT619736	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT619735	hsa-miR-764	HITS-CLIP	23824327
MIRT619734	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT619733	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT619732	hsa-miR-1248	HITS-CLIP	23824327
MIRT619726	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT619725	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT619724	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT629663	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT629662	hsa-miR-4757-5p	HITS-CLIP	23824327
MIRT629661	hsa-miR-6744-3p	HITS-CLIP	23824327
MIRT446577	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT619723	hsa-miR-640	HITS-CLIP	23824327
MIRT619722	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT619736	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT619735	hsa-miR-764	HITS-CLIP	23824327
MIRT619734	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT619733	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT619732	hsa-miR-1248	HITS-CLIP	23824327
MIRT619723	hsa-miR-640	HITS-CLIP	23824327
MIRT619736	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT619735	hsa-miR-764	HITS-CLIP	23824327
MIRT619734	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT619733	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT619732	hsa-miR-1248	HITS-CLIP	23824327
MIRT619731	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT619730	hsa-miR-373-5p	HITS-CLIP	23824327
MIRT619729	hsa-miR-616-5p	HITS-CLIP	23824327
MIRT619728	hsa-miR-371a-5p	HITS-CLIP	23824327
MIRT619727	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT619726	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT619725	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT619724	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT446577	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT619723	hsa-miR-640	HITS-CLIP	23824327
MIRT619722	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT446582	hsa-miR-3140-5p	PAR-CLIP	22100165
MIRT446581	hsa-miR-4427	PAR-CLIP	22100165
MIRT446580	hsa-miR-3160-3p	PAR-CLIP	22100165
MIRT446579	hsa-miR-558	PAR-CLIP	22100165
MIRT446578	hsa-miR-4487	PAR-CLIP	22100165
MIRT446577	hsa-miR-378a-5p	PAR-CLIP	22100165
MIRT446576	hsa-miR-1200	PAR-CLIP	22100165
MIRT446575	hsa-miR-3074-5p	PAR-CLIP	22100165
MIRT446574	hsa-miR-7152-5p	PAR-CLIP	22100165
MIRT446582	hsa-miR-3140-5p	PAR-CLIP	22100165
MIRT446581	hsa-miR-4427	PAR-CLIP	22100165
MIRT446580	hsa-miR-3160-3p	PAR-CLIP	22100165
MIRT446579	hsa-miR-558	PAR-CLIP	22100165
MIRT446578	hsa-miR-4487	PAR-CLIP	22100165
MIRT446577	hsa-miR-378a-5p	PAR-CLIP	22100165
MIRT446576	hsa-miR-1200	PAR-CLIP	22100165
MIRT446575	hsa-miR-3074-5p	PAR-CLIP	22100165
MIRT446574	hsa-miR-7152-5p	PAR-CLIP	22100165
MIRT735573	hsa-miR-20a-3p	ELISA	32217736
MIRT619736	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT619735	hsa-miR-764	HITS-CLIP	23824327
MIRT619734	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT619733	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT619732	hsa-miR-1248	HITS-CLIP	23824327
MIRT619731	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT619730	hsa-miR-373-5p	HITS-CLIP	23824327
MIRT619729	hsa-miR-616-5p	HITS-CLIP	23824327
MIRT619728	hsa-miR-371a-5p	HITS-CLIP	23824327
MIRT619727	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT619725	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT619724	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT446577	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT619723	hsa-miR-640	HITS-CLIP	23824327
MIRT619722	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT619736	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT619735	hsa-miR-764	HITS-CLIP	23824327
MIRT619734	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT619733	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT619732	hsa-miR-1248	HITS-CLIP	23824327
MIRT619726	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT619725	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT619724	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT446577	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT619723	hsa-miR-640	HITS-CLIP	23824327
MIRT619722	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT619736	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT619735	hsa-miR-764	HITS-CLIP	23824327
MIRT619734	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT619733	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT619732	hsa-miR-1248	HITS-CLIP	23824327
MIRT619723	hsa-miR-640	HITS-CLIP	23824327
MIRT619722	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT619736	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT619735	hsa-miR-764	HITS-CLIP	23824327
MIRT619734	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT619733	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT619732	hsa-miR-1248	HITS-CLIP	23824327
MIRT619726	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT619725	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT619724	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT446577	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT619723	hsa-miR-640	HITS-CLIP	23824327
MIRT619722	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT619736	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT619735	hsa-miR-764	HITS-CLIP	23824327
MIRT619734	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT619733	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT619732	hsa-miR-1248	HITS-CLIP	23824327
MIRT619726	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT619725	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT619724	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT446577	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT619723	hsa-miR-640	HITS-CLIP	23824327
MIRT619736	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT619735	hsa-miR-764	HITS-CLIP	23824327
MIRT619734	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT619733	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT619732	hsa-miR-1248	HITS-CLIP	23824327
MIRT619726	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT619725	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT619724	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT629663	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT629662	hsa-miR-4757-5p	HITS-CLIP	23824327
MIRT629661	hsa-miR-6744-3p	HITS-CLIP	23824327
MIRT446577	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT619723	hsa-miR-640	HITS-CLIP	23824327
MIRT619722	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT619736	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT619735	hsa-miR-764	HITS-CLIP	23824327
MIRT619734	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT619733	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT619732	hsa-miR-1248	HITS-CLIP	23824327
MIRT619723	hsa-miR-640	HITS-CLIP	23824327
MIRT619736	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT619735	hsa-miR-764	HITS-CLIP	23824327
MIRT619734	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT619733	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT619732	hsa-miR-1248	HITS-CLIP	23824327
MIRT619731	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT619730	hsa-miR-373-5p	HITS-CLIP	23824327
MIRT619729	hsa-miR-616-5p	HITS-CLIP	23824327
MIRT619728	hsa-miR-371a-5p	HITS-CLIP	23824327
MIRT619727	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT619726	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT619725	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT619724	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT446577	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT619723	hsa-miR-640	HITS-CLIP	23824327
MIRT619722	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT446582	hsa-miR-3140-5p	PAR-CLIP	22100165
MIRT446581	hsa-miR-4427	PAR-CLIP	22100165
MIRT446580	hsa-miR-3160-3p	PAR-CLIP	22100165
MIRT446579	hsa-miR-558	PAR-CLIP	22100165
MIRT446578	hsa-miR-4487	PAR-CLIP	22100165
MIRT446577	hsa-miR-378a-5p	PAR-CLIP	22100165
MIRT446576	hsa-miR-1200	PAR-CLIP	22100165
MIRT446575	hsa-miR-3074-5p	PAR-CLIP	22100165
MIRT446574	hsa-miR-7152-5p	PAR-CLIP	22100165
MIRT446582	hsa-miR-3140-5p	PAR-CLIP	22100165
MIRT446581	hsa-miR-4427	PAR-CLIP	22100165
MIRT446580	hsa-miR-3160-3p	PAR-CLIP	22100165
MIRT446579	hsa-miR-558	PAR-CLIP	22100165
MIRT446578	hsa-miR-4487	PAR-CLIP	22100165
MIRT446577	hsa-miR-378a-5p	PAR-CLIP	22100165
MIRT446576	hsa-miR-1200	PAR-CLIP	22100165
MIRT446575	hsa-miR-3074-5p	PAR-CLIP	22100165
MIRT446574	hsa-miR-7152-5p	PAR-CLIP	22100165
MIRT756313	hsa-let-7f-5p	qRT-PCR, Flow cytometry	35238350
MIRT1003955	hsa-miR-1264	CLIP-seq
MIRT1003956	hsa-miR-1914	CLIP-seq
MIRT1003957	hsa-miR-3127-3p	CLIP-seq
MIRT1003958	hsa-miR-3161	CLIP-seq
MIRT1003959	hsa-miR-3163	CLIP-seq
MIRT1003960	hsa-miR-3662	CLIP-seq
MIRT1003961	hsa-miR-3668	CLIP-seq
MIRT1003962	hsa-miR-4795-3p	CLIP-seq
MIRT1003963	hsa-miR-4803	CLIP-seq
MIRT1003964	hsa-miR-586	CLIP-seq
MIRT1003955	hsa-miR-1264	CLIP-seq
MIRT1003957	hsa-miR-3127-3p	CLIP-seq
MIRT1997576	hsa-miR-4766-3p	CLIP-seq
MIRT1003962	hsa-miR-4795-3p	CLIP-seq
MIRT1003955	hsa-miR-1264	CLIP-seq
MIRT1003957	hsa-miR-3127-3p	CLIP-seq
MIRT1003962	hsa-miR-4795-3p	CLIP-seq
MIRT1003955	hsa-miR-1264	CLIP-seq
MIRT1003957	hsa-miR-3127-3p	CLIP-seq
MIRT1003961	hsa-miR-3668	CLIP-seq
MIRT2388169	hsa-miR-374c	CLIP-seq
MIRT2388170	hsa-miR-4517	CLIP-seq
MIRT2388171	hsa-miR-4666-5p	CLIP-seq
MIRT1003962	hsa-miR-4795-3p	CLIP-seq
MIRT2388172	hsa-miR-591	CLIP-seq
MIRT2388173	hsa-miR-655	CLIP-seq
MIRT1003955	hsa-miR-1264	CLIP-seq
MIRT1003957	hsa-miR-3127-3p	CLIP-seq
MIRT1003962	hsa-miR-4795-3p	CLIP-seq
MIRT1003955	hsa-miR-1264	CLIP-seq
MIRT1003957	hsa-miR-3127-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001540	Function	Amyloid-beta binding	IPI	11316806
GO:0001540	Function	Amyloid-beta binding	ISS
GO:0001774	Process	Microglial cell activation	IEA
GO:0001774	Process	Microglial cell activation	ISS
GO:0002430	Process	Complement receptor mediated signaling pathway	IBA
GO:0002768	Process	Immune response-regulating cell surface receptor signaling pathway	IDA	25505240
GO:0004875	Function	Complement receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	NAS	11316806, 20141570
GO:0004930	Function	G protein-coupled receptor activity	TAS	9054386
GO:0004982	Function	N-formyl peptide receptor activity	IBA
GO:0004982	Function	N-formyl peptide receptor activity	TAS	1374236
GO:0005124	Function	Scavenger receptor binding	IPI	20141570
GO:0005515	Function	Protein binding	IPI	15465011, 20141570, 32296183, 32814053
GO:0005737	Component	Cytoplasm	IDA	11689470
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	11689470, 15465011
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9054386
GO:0006898	Process	Receptor-mediated endocytosis	IEA
GO:0006898	Process	Receptor-mediated endocytosis	ISS
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	TAS	9054386
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	TAS	9054386
GO:0007154	Process	Cell communication	IEA
GO:0007155	Process	Cell adhesion	TAS	9054386
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IDA	25505240
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IGI	11160457
GO:0007186	Process	G protein-coupled receptor signaling pathway	NAS	11316806
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	9054386
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IGI	20141570
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	ISS
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IBA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9054386
GO:0019722	Process	Calcium-mediated signaling	IGI	11160457
GO:0023052	Process	Signaling	IEA
GO:0032930	Process	Positive regulation of superoxide anion generation	ISS
GO:0035579	Component	Specific granule membrane	TAS
GO:0038023	Function	Signaling receptor activity	IDA	25505240
GO:0038024	Function	Cargo receptor activity	IEA
GO:0038024	Function	Cargo receptor activity	ISS
GO:0042742	Process	Defense response to bacterium	IDA	25505240
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0045089	Process	Positive regulation of innate immune response	IDA	25505240
GO:0048143	Process	Astrocyte activation	IEA
GO:0048143	Process	Astrocyte activation	ISS
GO:0050728	Process	Negative regulation of inflammatory response	IDA	25505240
GO:0050766	Process	Positive regulation of phagocytosis	IDA	25505240
GO:0050786	Function	RAGE receptor binding	IEA
GO:0050918	Process	Positive chemotaxis	ISS
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IGI	20141570
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	20141570
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	ISS
GO:0070821	Component	Tertiary granule membrane	TAS
GO:0090026	Process	Positive regulation of monocyte chemotaxis	IGI	11160457
GO:0097187	Process	Dentinogenesis	IEA
GO:0101003	Component	Ficolin-1-rich granule membrane	TAS
GO:1904646	Process	Cellular response to amyloid-beta	IDA	11316806
GO:1904646	Process	Cellular response to amyloid-beta	IEA
GO:1904646	Process	Cellular response to amyloid-beta	ISS

Other IDs

• MIM: 136538
• HGNC: 3827
• e!Ensembl: ENSG00000171049

Protein

• UniProt ID: P25090
• Protein name: N-formyl peptide receptor 2 (FMLP-related receptor I) (FMLP-R-I) (Formyl peptide receptor-like 1) (HM63) (Lipoxin A4 receptor) (LXA4 receptor) (RFP)
• Protein function: Low affinity receptor for N-formyl-methionyl peptides, which are powerful neutrophil chemotactic factors (PubMed:1374236). Binding of FMLP to the receptor causes activation of neutrophils (PubMed:1374236). This response is mediated via a G-prote
• PDB: 6LW5, 6OMM, 7T6S, 7T6U, 7T6V, 7WVV, 7WVW, 7WVX, 7WVY, 8Y62, 8Y63
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	43 → 302	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected in lung, bone marrow, neutrophils, spleen and testis. {ECO:0000269|PubMed:15465011, ECO:0000269|PubMed:9151906}.
• Sequence:

  METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVT
  TICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIA
  LDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNF
  ASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPL
  RVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPM
  LYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM

• Sequence length: 351

Pathways

KEGG:

Neuroactive ligand-receptor interaction
Neutrophil extracellular trap formation
Staphylococcus aureus infection

Reactome:

G alpha (q) signalling events
G alpha (i) signalling events
Formyl peptide receptors bind formyl peptides and many other ligands
Neutrophil degranulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CROHN DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung adenocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	16212921, 20141570, 33804025, 33811735	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	26107889		★☆☆☆☆ Found in Text Mining only
Anemia, Diamond-Blackfan	Anemia	BEFREE	15771965		★☆☆☆☆ Found in Text Mining only
Arrhythmogenic Right Ventricular Dysplasia	Arrhythmogenic right ventricular cardiomyopathy	Pubtator	30664203	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	19167353, 23500463, 25341894, 28071789		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	15171815, 15188355		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	15171815, 15188355	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	LHGDN	15188355		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15188355, 28316377	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	18583575		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	18583575	Inhibit	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	30102794		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	34727921, 36197221	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	11063827, 17727628, 30286327		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	19167353, 23500463, 25341894, 28071789		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	22541858	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	33741890, 34938350	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35045088, 36414640	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22524660		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	29039544	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	29039544		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	36035865	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	34140767	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	31525508		★☆☆☆☆ Found in Text Mining only
Chondroma	Chondroma	BEFREE	29106539		★☆☆☆☆ Found in Text Mining only
Choreoathetosis Hypothyroidism And Neonatal Respiratory Distress	Choreoathetosis	Pubtator	35045088	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	29544524		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	29102463		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	31234710		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	30061205		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31288528		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29364475	Associate	★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia due to 21 hydroxylase deficiency	Congenital adrenal hyperplasia	BEFREE	1977680		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	21659618		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	CTD_human_DG	21659618		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	21659618	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn`s disease of large bowel	Crohn`s Disease Of Large Bowel	CTD_human_DG	21659618		★☆☆☆☆ Found in Text Mining only
Crohn`s disease of the ileum	Crohn`s Disease Of The Ileum	CTD_human_DG	21659618		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	29044225		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	29044225	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	17918787		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	Pubtator	17460114	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	34235813	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	24838153		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	31023998		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	15996849, 30096622		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	36301030	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	29039544		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36963399	Associate	★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia of Taylor	Focal cortical dysplasia	Pubtator	36301030	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23253700		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	30029622	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	31116781		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	26276873		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	26276873	Associate	★☆☆☆☆ Found in Text Mining only
IIeocolitis	Ileocolitis	CTD_human_DG	21659618		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	21659618, 29180648		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	35022690	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	22723974	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28886014		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	25490767	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26459277, 30999932		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	37465678	Associate	★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Cortical development malformation	Pubtator	36301030	Inhibit	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22524660		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21491421		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28600569		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	28288391		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19351825, 19796867, 22524660, 25263443, 30286327, 30483856, 30999932		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19351825, 30061205		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	20930115, 30576620		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	20422010, 26033450		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	31629396		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	30862681		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	31178714		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	35692878	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	32922167	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	35049167	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	27790799, 28169296, 31216426		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	33847684	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16855381, 19221501, 25016285, 25483261, 25616355, 27863373, 28192065, 28668831, 28811223, 30286327, 31191817, 31515263		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	20141570	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	21299846		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31232177		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	30134951		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30862681		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	28316377	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	37335694	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	12413468, 28314258		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19491199	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29039544	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21491421		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	12787916		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	31354022		★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	29312335		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	27910163		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	29544524, 31419078, 35129068	Associate	★☆☆☆☆ Found in Text Mining only
Regional enteritis	Crohn Disease	CTD_human_DG	21659618		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	22377711		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	15188355, 28316377, 30279454		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	17918787		★☆☆☆☆ Found in Text Mining only
Sarcoidosis Pulmonary	Sarcoidosis	Pubtator	39364409	Stimulate	★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	31552041		★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	11160457		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	28679406	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	25512512, 28679406		★☆☆☆☆ Found in Text Mining only
Severe Aplastic Anemia	Anemia	BEFREE	27910163		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	22205391, 34847389	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	31116781	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	31116781		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25490767	Associate	★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29515134		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28600569		★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	30117729		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	31552041		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	36301030	Inhibit	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	24030327		★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	37465678	Associate	★☆☆☆☆ Found in Text Mining only