Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2357
Gene name	Formyl peptide receptor 1
Gene symbol	FPR1
Synonyms (NCBI Gene)	FMLPFPR
Chromosome	19
Chromosome location	19q13.41
Summary	This gene encodes a G protein-coupled receptor of mammalian phagocytic cells that is a member of the G-protein coupled receptor 1 family. The protein mediates the response of phagocytic cells to invasion of the host by microorganisms and is important in h

198

Show/Hide all (198)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018871	hsa-miR-335-5p	Microarray	18185580
MIRT715707	hsa-miR-4722-3p	HITS-CLIP	19536157
MIRT715708	hsa-miR-6727-3p	HITS-CLIP	19536157
MIRT715706	hsa-miR-6747-3p	HITS-CLIP	19536157
MIRT689335	hsa-miR-3653-5p	HITS-CLIP	19536157
MIRT689334	hsa-miR-1976	HITS-CLIP	19536157
MIRT715705	hsa-miR-4279	HITS-CLIP	19536157
MIRT715704	hsa-miR-498	HITS-CLIP	19536157
MIRT689342	hsa-miR-4428	HITS-CLIP	23313552
MIRT689341	hsa-miR-3173-3p	HITS-CLIP	23313552
MIRT689339	hsa-miR-6891-5p	HITS-CLIP	23313552
MIRT689340	hsa-miR-4293	HITS-CLIP	23313552
MIRT689338	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT689337	hsa-miR-4324	HITS-CLIP	23313552
MIRT689336	hsa-miR-544b	HITS-CLIP	23313552
MIRT689335	hsa-miR-3653-5p	HITS-CLIP	23313552
MIRT689334	hsa-miR-1976	HITS-CLIP	23313552
MIRT689333	hsa-miR-7162-3p	HITS-CLIP	23313552
MIRT689332	hsa-miR-4786-5p	HITS-CLIP	23313552
MIRT689331	hsa-let-7a-5p	HITS-CLIP	23313552
MIRT689330	hsa-let-7b-5p	HITS-CLIP	23313552
MIRT689329	hsa-let-7c-5p	HITS-CLIP	23313552
MIRT689328	hsa-let-7d-5p	HITS-CLIP	23313552
MIRT689327	hsa-let-7e-5p	HITS-CLIP	23313552
MIRT689326	hsa-let-7f-5p	HITS-CLIP	23313552
MIRT689325	hsa-let-7g-5p	HITS-CLIP	23313552
MIRT689324	hsa-let-7i-5p	HITS-CLIP	23313552
MIRT689322	hsa-miR-4458	HITS-CLIP	23313552
MIRT689323	hsa-miR-4500	HITS-CLIP	23313552
MIRT689321	hsa-miR-98-5p	HITS-CLIP	23313552
MIRT689320	hsa-miR-202-3p	HITS-CLIP	23313552
MIRT689319	hsa-miR-1200	HITS-CLIP	23313552
MIRT617088	hsa-miR-4502	HITS-CLIP	23824327
MIRT661118	hsa-miR-4481	HITS-CLIP	23824327
MIRT661117	hsa-miR-4745-5p	HITS-CLIP	23824327
MIRT617087	hsa-miR-3119	HITS-CLIP	23824327
MIRT617086	hsa-miR-3192-3p	HITS-CLIP	23824327
MIRT661116	hsa-miR-1238-5p	HITS-CLIP	23824327
MIRT661115	hsa-miR-4758-5p	HITS-CLIP	23824327
MIRT617085	hsa-miR-4762-3p	HITS-CLIP	23824327
MIRT661114	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT661113	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT661112	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT661111	hsa-miR-4533	HITS-CLIP	23824327
MIRT661110	hsa-miR-3202	HITS-CLIP	23824327
MIRT661109	hsa-miR-6079	HITS-CLIP	23824327
MIRT642315	hsa-miR-4781-3p	HITS-CLIP	23824327
MIRT642314	hsa-miR-6823-5p	HITS-CLIP	23824327
MIRT642313	hsa-miR-4716-5p	HITS-CLIP	23824327
MIRT642312	hsa-miR-26b-3p	HITS-CLIP	23824327
MIRT642311	hsa-miR-4755-3p	HITS-CLIP	23824327
MIRT642310	hsa-miR-4687-3p	HITS-CLIP	23824327
MIRT642309	hsa-miR-2117	HITS-CLIP	23824327
MIRT642308	hsa-miR-197-3p	HITS-CLIP	23824327
MIRT642307	hsa-miR-516a-5p	HITS-CLIP	23824327
MIRT642306	hsa-miR-548s	HITS-CLIP	23824327
MIRT642305	hsa-miR-4701-5p	HITS-CLIP	23824327
MIRT642304	hsa-miR-588	HITS-CLIP	23824327
MIRT642303	hsa-miR-4435	HITS-CLIP	23824327
MIRT642302	hsa-miR-3187-3p	HITS-CLIP	23824327
MIRT642301	hsa-miR-4273	HITS-CLIP	23824327
MIRT642300	hsa-miR-7156-5p	HITS-CLIP	23824327
MIRT642299	hsa-miR-5096	HITS-CLIP	23824327
MIRT630727	hsa-miR-1306-5p	HITS-CLIP	23824327
MIRT642298	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT630726	hsa-miR-4308	HITS-CLIP	23824327
MIRT630725	hsa-miR-4292	HITS-CLIP	23824327
MIRT630724	hsa-miR-6791-5p	HITS-CLIP	23824327
MIRT642297	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT630723	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT630722	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT639057	hsa-miR-382-3p	HITS-CLIP	23824327
MIRT639056	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT639055	hsa-miR-3927-5p	HITS-CLIP	23824327
MIRT639054	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT639053	hsa-miR-2277-3p	HITS-CLIP	23824327
MIRT639052	hsa-miR-103a-2-5p	HITS-CLIP	23824327
MIRT639051	hsa-miR-188-3p	HITS-CLIP	23824327
MIRT639050	hsa-miR-1260a	HITS-CLIP	23824327
MIRT639049	hsa-miR-1260b	HITS-CLIP	23824327
MIRT639048	hsa-miR-3156-3p	HITS-CLIP	23824327
MIRT639047	hsa-miR-337-3p	HITS-CLIP	23824327
MIRT639046	hsa-miR-202-5p	HITS-CLIP	23824327
MIRT630727	hsa-miR-1306-5p	HITS-CLIP	23824327
MIRT630726	hsa-miR-4308	HITS-CLIP	23824327
MIRT630725	hsa-miR-4292	HITS-CLIP	23824327
MIRT630724	hsa-miR-6791-5p	HITS-CLIP	23824327
MIRT630723	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT630722	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT630721	hsa-miR-1297	HITS-CLIP	23824327
MIRT630720	hsa-miR-26a-5p	HITS-CLIP	23824327
MIRT630719	hsa-miR-26b-5p	HITS-CLIP	23824327
MIRT630718	hsa-miR-4465	HITS-CLIP	23824327
MIRT617088	hsa-miR-4502	HITS-CLIP	23824327
MIRT617087	hsa-miR-3119	HITS-CLIP	23824327
MIRT617086	hsa-miR-3192-3p	HITS-CLIP	23824327
MIRT617085	hsa-miR-4762-3p	HITS-CLIP	23824327
MIRT661113	hsa-miR-383-3p	HITS-CLIP	27418678
MIRT642303	hsa-miR-4435	HITS-CLIP	27418678
MIRT642303	hsa-miR-4435	HITS-CLIP	27418678
MIRT642311	hsa-miR-4755-3p	HITS-CLIP	27418678
MIRT642311	hsa-miR-4755-3p	HITS-CLIP	27418678
MIRT715707	hsa-miR-4722-3p	HITS-CLIP	19536157
MIRT715708	hsa-miR-6727-3p	HITS-CLIP	19536157
MIRT715706	hsa-miR-6747-3p	HITS-CLIP	19536157
MIRT689335	hsa-miR-3653-5p	HITS-CLIP	19536157
MIRT689334	hsa-miR-1976	HITS-CLIP	19536157
MIRT715705	hsa-miR-4279	HITS-CLIP	19536157
MIRT715704	hsa-miR-498	HITS-CLIP	19536157
MIRT689342	hsa-miR-4428	HITS-CLIP	23313552
MIRT689341	hsa-miR-3173-3p	HITS-CLIP	23313552
MIRT689339	hsa-miR-6891-5p	HITS-CLIP	23313552
MIRT689340	hsa-miR-4293	HITS-CLIP	23313552
MIRT689338	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT689337	hsa-miR-4324	HITS-CLIP	23313552
MIRT689336	hsa-miR-544b	HITS-CLIP	23313552
MIRT689335	hsa-miR-3653-5p	HITS-CLIP	23313552
MIRT689334	hsa-miR-1976	HITS-CLIP	23313552
MIRT689333	hsa-miR-7162-3p	HITS-CLIP	23313552
MIRT689332	hsa-miR-4786-5p	HITS-CLIP	23313552
MIRT689331	hsa-let-7a-5p	HITS-CLIP	23313552
MIRT689330	hsa-let-7b-5p	HITS-CLIP	23313552
MIRT689329	hsa-let-7c-5p	HITS-CLIP	23313552
MIRT689328	hsa-let-7d-5p	HITS-CLIP	23313552
MIRT689327	hsa-let-7e-5p	HITS-CLIP	23313552
MIRT689326	hsa-let-7f-5p	HITS-CLIP	23313552
MIRT689325	hsa-let-7g-5p	HITS-CLIP	23313552
MIRT689324	hsa-let-7i-5p	HITS-CLIP	23313552
MIRT689322	hsa-miR-4458	HITS-CLIP	23313552
MIRT689323	hsa-miR-4500	HITS-CLIP	23313552
MIRT689321	hsa-miR-98-5p	HITS-CLIP	23313552
MIRT689320	hsa-miR-202-3p	HITS-CLIP	23313552
MIRT689319	hsa-miR-1200	HITS-CLIP	23313552
MIRT617088	hsa-miR-4502	HITS-CLIP	23824327
MIRT661118	hsa-miR-4481	HITS-CLIP	23824327
MIRT661117	hsa-miR-4745-5p	HITS-CLIP	23824327
MIRT617087	hsa-miR-3119	HITS-CLIP	23824327
MIRT617086	hsa-miR-3192-3p	HITS-CLIP	23824327
MIRT661116	hsa-miR-1238-5p	HITS-CLIP	23824327
MIRT661115	hsa-miR-4758-5p	HITS-CLIP	23824327
MIRT617085	hsa-miR-4762-3p	HITS-CLIP	23824327
MIRT661114	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT661113	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT661112	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT661111	hsa-miR-4533	HITS-CLIP	23824327
MIRT661110	hsa-miR-3202	HITS-CLIP	23824327
MIRT661109	hsa-miR-6079	HITS-CLIP	23824327
MIRT642315	hsa-miR-4781-3p	HITS-CLIP	23824327
MIRT642314	hsa-miR-6823-5p	HITS-CLIP	23824327
MIRT642313	hsa-miR-4716-5p	HITS-CLIP	23824327
MIRT642312	hsa-miR-26b-3p	HITS-CLIP	23824327
MIRT642311	hsa-miR-4755-3p	HITS-CLIP	23824327
MIRT642310	hsa-miR-4687-3p	HITS-CLIP	23824327
MIRT642309	hsa-miR-2117	HITS-CLIP	23824327
MIRT642308	hsa-miR-197-3p	HITS-CLIP	23824327
MIRT642307	hsa-miR-516a-5p	HITS-CLIP	23824327
MIRT642306	hsa-miR-548s	HITS-CLIP	23824327
MIRT642305	hsa-miR-4701-5p	HITS-CLIP	23824327
MIRT642304	hsa-miR-588	HITS-CLIP	23824327
MIRT642303	hsa-miR-4435	HITS-CLIP	23824327
MIRT642302	hsa-miR-3187-3p	HITS-CLIP	23824327
MIRT642301	hsa-miR-4273	HITS-CLIP	23824327
MIRT642300	hsa-miR-7156-5p	HITS-CLIP	23824327
MIRT642299	hsa-miR-5096	HITS-CLIP	23824327
MIRT630727	hsa-miR-1306-5p	HITS-CLIP	23824327
MIRT642298	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT630726	hsa-miR-4308	HITS-CLIP	23824327
MIRT630725	hsa-miR-4292	HITS-CLIP	23824327
MIRT630724	hsa-miR-6791-5p	HITS-CLIP	23824327
MIRT642297	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT630723	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT630722	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT639057	hsa-miR-382-3p	HITS-CLIP	23824327
MIRT639056	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT639055	hsa-miR-3927-5p	HITS-CLIP	23824327
MIRT639054	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT639053	hsa-miR-2277-3p	HITS-CLIP	23824327
MIRT639052	hsa-miR-103a-2-5p	HITS-CLIP	23824327
MIRT639051	hsa-miR-188-3p	HITS-CLIP	23824327
MIRT639050	hsa-miR-1260a	HITS-CLIP	23824327
MIRT639049	hsa-miR-1260b	HITS-CLIP	23824327
MIRT639048	hsa-miR-3156-3p	HITS-CLIP	23824327
MIRT639047	hsa-miR-337-3p	HITS-CLIP	23824327
MIRT639046	hsa-miR-202-5p	HITS-CLIP	23824327
MIRT630727	hsa-miR-1306-5p	HITS-CLIP	23824327
MIRT630726	hsa-miR-4308	HITS-CLIP	23824327
MIRT630725	hsa-miR-4292	HITS-CLIP	23824327
MIRT630724	hsa-miR-6791-5p	HITS-CLIP	23824327
MIRT630723	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT630722	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT630721	hsa-miR-1297	HITS-CLIP	23824327
MIRT630720	hsa-miR-26a-5p	HITS-CLIP	23824327
MIRT630719	hsa-miR-26b-5p	HITS-CLIP	23824327
MIRT630718	hsa-miR-4465	HITS-CLIP	23824327
MIRT617088	hsa-miR-4502	HITS-CLIP	23824327
MIRT617087	hsa-miR-3119	HITS-CLIP	23824327
MIRT617086	hsa-miR-3192-3p	HITS-CLIP	23824327
MIRT617085	hsa-miR-4762-3p	HITS-CLIP	23824327

Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001664	Function	G protein-coupled receptor binding	IDA	10823817
GO:0002430	Process	Complement receptor mediated signaling pathway	IBA
GO:0004875	Function	Complement receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IDA	15210802
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004982	Function	N-formyl peptide receptor activity	IBA
GO:0004982	Function	N-formyl peptide receptor activity	IDA	12218158, 22859307
GO:0004982	Function	N-formyl peptide receptor activity	IEA
GO:0004982	Function	N-formyl peptide receptor activity	TAS	10820279
GO:0005124	Function	Scavenger receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	22447027
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS	10823817, 10882119
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	TAS	10857861
GO:0006954	Process	Inflammatory response	IBA
GO:0007154	Process	Cell communication	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	10820279
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	10823817
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	TAS	10889468
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IBA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IDA	22859307
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0007263	Process	Nitric oxide mediated signal transduction	TAS	10861041
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	2161213
GO:0023052	Process	Signaling	IEA
GO:0030667	Component	Secretory granule membrane	TAS
GO:0035577	Component	Azurophil granule membrane	TAS
GO:0050786	Function	RAGE receptor binding	IEA
GO:0101003	Component	Ficolin-1-rich granule membrane	TAS

MIM	HGNC	e!Ensembl
136537	3826	ENSG00000171051

P21462

Protein name

fMet-Leu-Phe receptor (fMLP receptor) (N-formyl peptide receptor) (FPR) (N-formylpeptide chemoattractant receptor)

Protein function

High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil chemotactic factors (PubMed:10514456, PubMed:15153520, PubMed:2161213, PubMed:2176894). Binding of fMLP to the receptor stimulates intracellular calcium

PDB

7EUO , 7T6T , 7VFX , 7WVU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	43 → 301	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Neutrophils.

Sequence

METNSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVT
TISYLNLAVADFCFTSTLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIA
LDRCVCVLHPVWTQNHRTVSLAKKVIIGPWVMALLLTLPVIIRVTTVPGKTGTVACTFNF
SPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSYGLIATKIHKQGLIKSSRPL
RVLSFVAAAFFLCWSPYQVVALIATVRIRELLQGMYKEIGIAVDVTSALAFFNSCLNPML
YVFMGQDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK

Sequence length

350

Interactions

View interactions

	KEGG		Reactome
	Rap1 signaling pathway Neuroactive ligand-receptor interaction Neutrophil extracellular trap formation Staphylococcus aureus infection		G alpha (i) signalling events Formyl peptide receptors bind formyl peptides and many other ligands Interleukin-10 signaling Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CERVICAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FPR1 POLYMORPHISM	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FPR1-related disorder	Likely benign; Uncertain significance; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GILLES DE LA TOURETTE SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GINGIVAL DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gingival disorder	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Periodontitis	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Prostate cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (95)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	29254791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	25277308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	10534074, 12595898, 15195697, 17927965, 19254133, 19722801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	11160457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	GWASCAT_DG	29942085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arrhythmogenic Right Ventricular Dysplasia	Arrhythmogenic right ventricular cardiomyopathy	Pubtator	30664203	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	33602227	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	39198660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29665744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29932988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35045088, 35626741, 36970071	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	30356317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	29665744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29313979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	31703596	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31703596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	39198660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30098789, 30510453, 31772669		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	30098789, 30510453, 31772669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choreoathetosis Hypothyroidism And Neonatal Respiratory Distress	Choreoathetosis	Pubtator	35045088	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	29544524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ciliary Motility Disorders	Ciliary dyskinesia	Pubtator	29116124	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30711419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	35876170	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28724995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30649440	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	39475676	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	37773841	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	39198660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	23891271	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	25201101, 30140375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	31703596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	29254791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	25277308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	23103287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	15651980	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	19037090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23523627, 25894595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23523627, 25894595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	15928303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	18523971, 20933627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	38049523	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	25277308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	37108173	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	36248794	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	31010956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	21144844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	35022690	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	36081453	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	40389926	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	22287738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	28232203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	29313979, 37073135	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	2974768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	25277308	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29932988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29313979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	21216225, 25263443, 28507800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29665744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25263443, 26516201, 31534221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30098789, 30510453, 31772669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	20930115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	33345275	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29216889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	29216889	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	29216889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28169296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	29381915, 32594092, 39198660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25263443, 27432059, 28724995, 29254791, 30510453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	27432059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	40165145	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31703596, 33287740, 38115318	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33353163	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	33632146	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal ventricular fibrillation	Paroxysmal ventricular fibrillation	Pubtator	23891271	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	21216225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	21216225		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Periodontitis	Periodontitis	GENOMICS_ENGLAND_DG	29105764		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Periodontitis	Periodontitis	Pubtator	36412285	Associate	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Primary Ciliary Dyskinesia	Ciliary dyskinesia	BEFREE	29116124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	29544524, 31419078	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	18253729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	22287738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	27681120	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schwartz-Jampel Syndrome	Schwartz-Jampel Syndrome	BEFREE	27154258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	31743227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	31116781	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	31116781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	29313979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	23103287, 26760234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	21216225, 25263443, 28507800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Susceptibility to localized juvenile periodontitis	Periodontitis	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	27154258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29932988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	29665744, 34404901	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

FPR1 (formyl peptide receptor 1)