Gene Gene information from NCBI Gene database.
Entrez ID 23567
Gene name Zinc finger protein 346
Gene symbol ZNF346
Synonyms (NCBI Gene)
JAZZfp346
Chromosome 5
Chromosome location 5q35.2
Summary The protein encoded by this gene is a nucleolar, zinc finger protein that preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids, rather than DNA alone. Mutational studies indicate that the zinc finger domains are not only essential for dsRNA
miRNA miRNA information provided by mirtarbase database.
347
miRTarBase ID miRNA Experiments Reference
MIRT024584 hsa-miR-215-5p Microarray 19074876
MIRT026748 hsa-miR-192-5p Microarray 19074876
MIRT050336 hsa-miR-25-3p CLASH 23622248
MIRT045438 hsa-miR-149-5p CLASH 23622248
MIRT1522952 hsa-miR-1238 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17
GO ID Ontology Definition Evidence Reference
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding HDA 22681889
GO:0003723 Function RNA binding IEA
GO:0003725 Function Double-stranded RNA binding IBA
GO:0003725 Function Double-stranded RNA binding IDA 10488071
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605308 16403 ENSG00000113761
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UL40
Protein name Zinc finger protein 346 (Just another zinc finger protein)
Protein function Binds with low affinity to dsDNA and ssRNA, and with high affinity to dsRNA, with no detectable sequence specificity (PubMed:24521053). May bind to specific miRNA hairpins (PubMed:28431233). {ECO:0000269|PubMed:24521053, ECO:0000269|PubMed:28431
PDB 2MKD , 2MKN
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12874 zf-met 73 97 Domain
PF12874 zf-met 135 158 Domain
PF12874 zf-met 185 209 Domain
PF12874 zf-met 239 263 Domain
Sequence
MEYPAPATVQAADGGAAGPYSSSELLEGQEPDGVRFDRERARRLWEAVSGAQPVGREEVE
HMIQKNQCLFTNTQCKVCCALLISESQKLAHYQSKKHANKVKRYLAIHGMETLKGETKKL
DSDQKSSRSKDKNQCCPICNMTFSSPVVAQSHYLGKTHAKNLKLKQQSTKVEALHQNREM
IDPDKFCSLCHATFNDPVMAQQHYVGKKHRKQETKLKLMARYGRLADPAVTDFPAGKGYP
CKTCKIVLNSIEQYQAHVSGFKH
KNQSPKTVASSLGQIPMQRQPIQKDSTTLED
Sequence length 294
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
INSOMNIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 36834567 Associate
★☆☆☆☆
Found in Text Mining only
Gout Gout Pubtator 35813414 Associate
★☆☆☆☆
Found in Text Mining only
Hepatitis B Hepatitis b Pubtator 36834567 Stimulate
★☆☆☆☆
Found in Text Mining only
Neuroblastoma Neuroblastoma BEFREE 29793538
★☆☆☆☆
Found in Text Mining only
Neuroblastoma Neuroblastoma Pubtator 29793538 Associate
★☆☆☆☆
Found in Text Mining only
Plexiform leiomyoma Plexiform leiomyoma GWASCAT_DG 30194396, 31649266
★☆☆☆☆
Found in Text Mining only
Uterine Fibroids Uterine Fibroids GWASCAT_DG 30194396, 31649266
★☆☆☆☆
Found in Text Mining only