DDAH2 (DDAH family member 2, ADMA-independent)

Gene

• Entrez ID: 23564
• Gene name: DDAH family member 2, ADMA-independent
• Gene symbol: DDAH2
• Synonyms (NCBI Gene): DDAH, DDAHII, G6a, HEL-S-277, NG30
• Chromosome: 6
• Chromosome location: 6p21.33
• Summary: This gene encodes a dimethylarginine dimethylaminohydrolase. The encoded enzyme functions in nitric oxide generation by regulating the cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. The protein may be loc

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT025565	hsa-miR-34a-5p	Proteomics	21566225
MIRT928703	hsa-miR-1321	CLIP-seq
MIRT928704	hsa-miR-3130-5p	CLIP-seq
MIRT928705	hsa-miR-331-3p	CLIP-seq
MIRT928706	hsa-miR-3681	CLIP-seq
MIRT928707	hsa-miR-3922-5p	CLIP-seq
MIRT928708	hsa-miR-3974	CLIP-seq
MIRT928709	hsa-miR-4251	CLIP-seq
MIRT928710	hsa-miR-4303	CLIP-seq
MIRT928711	hsa-miR-4329	CLIP-seq
MIRT928712	hsa-miR-4419a	CLIP-seq
MIRT928713	hsa-miR-4435	CLIP-seq
MIRT928714	hsa-miR-4446-5p	CLIP-seq
MIRT928715	hsa-miR-4482	CLIP-seq
MIRT928716	hsa-miR-4510	CLIP-seq
MIRT928717	hsa-miR-4530	CLIP-seq
MIRT928718	hsa-miR-4739	CLIP-seq
MIRT928719	hsa-miR-4753-5p	CLIP-seq
MIRT928720	hsa-miR-4755-3p	CLIP-seq
MIRT928721	hsa-miR-4755-5p	CLIP-seq
MIRT928722	hsa-miR-4756-5p	CLIP-seq
MIRT928723	hsa-miR-501-5p	CLIP-seq
MIRT928724	hsa-miR-659	CLIP-seq
MIRT1975048	hsa-miR-1179	CLIP-seq
MIRT1975049	hsa-miR-150	CLIP-seq
MIRT1975050	hsa-miR-4291	CLIP-seq
MIRT1975051	hsa-miR-4310	CLIP-seq
MIRT1975052	hsa-miR-4461	CLIP-seq
MIRT1975053	hsa-miR-4684-5p	CLIP-seq
MIRT1975054	hsa-miR-4713-5p	CLIP-seq
MIRT1975055	hsa-miR-532-3p	CLIP-seq
MIRT1975056	hsa-miR-606	CLIP-seq
MIRT928703	hsa-miR-1321	CLIP-seq
MIRT928704	hsa-miR-3130-5p	CLIP-seq
MIRT2210454	hsa-miR-3162-3p	CLIP-seq
MIRT2210455	hsa-miR-361-3p	CLIP-seq
MIRT928706	hsa-miR-3681	CLIP-seq
MIRT928709	hsa-miR-4251	CLIP-seq
MIRT928710	hsa-miR-4303	CLIP-seq
MIRT928711	hsa-miR-4329	CLIP-seq
MIRT928712	hsa-miR-4419a	CLIP-seq
MIRT928714	hsa-miR-4446-5p	CLIP-seq
MIRT928715	hsa-miR-4482	CLIP-seq
MIRT928716	hsa-miR-4510	CLIP-seq
MIRT2210456	hsa-miR-4639-3p	CLIP-seq
MIRT928718	hsa-miR-4739	CLIP-seq
MIRT928721	hsa-miR-4755-5p	CLIP-seq
MIRT928722	hsa-miR-4756-5p	CLIP-seq
MIRT928723	hsa-miR-501-5p	CLIP-seq
MIRT928724	hsa-miR-659	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000052	Process	Citrulline metabolic process	IDA	21493890, 37296100
GO:0005515	Function	Protein binding	IPI	16189514, 19060904, 22046132, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0016403	Function	Dimethylargininase activity	IDA	21493890, 37296100
GO:0016403	Function	Dimethylargininase activity	IGI	37296100
GO:0016403	Function	Dimethylargininase activity	IKR	37296100
GO:0016403	Function	Dimethylargininase activity	IMP	37296100
GO:0016787	Function	Hydrolase activity	IEA
GO:0043066	Process	Negative regulation of apoptotic process	TAS	16130169
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145

Other IDs

• MIM: 604744
• HGNC: 2716
• e!Ensembl: ENSG00000213722

Protein

• UniProt ID: O95865
• Protein name: Putative hydrolase DDAH2 (EC 3.-.-.-) (DDAHII) (Inactive N(G),N(G)-dimethylarginine dimethylaminohydrolase 2) (DDAH-2) (Inactive dimethylarginine dimethylaminohydrolase 2) (Protein G6a) (S-phase protein)
• Protein function: Putative hydrolase with unknown substrate (Probable). Does not hydrolyze N(G),N(G)-dimethyl-L-arginine (ADMA) which acts as an inhibitor of NOS (PubMed:21493890, PubMed:37296100). In endothelial cells, induces expression of vascular endothelial
• Tissue specificity: TISSUE SPECIFICITY: Detected in heart, placenta, lung, liver, skeletal muscle, kidney and pancreas, and at very low levels in brain. {ECO:0000269|PubMed:10493931}.
• Sequence:

  MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGGKLRQRLGLQL
  LELPPEESLPLGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRKALQDLGLRIVEIGDE
  NATLDGTDVLFTGREFFVGLSKWTNHRGAEIVADTFRDFAVSTVPVSGPSHLRGLCGMGG
  PRTVVAGSSDAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLRPGLPGVPPFLLHRGGG
  DLPNSQEALQKLSDVTLVPVSCSELEKAGAGLSSLCLVLSTRPHS

• Sequence length: 285

Pathways

Reactome:

eNOS activation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRE-ECLAMPSIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arteriosclerosis	Arteriosclerosis	BEFREE	24934151		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	24934151		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	24934151	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	26663142		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	30569164		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	14550280, 23171931, 24186881		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	19250061		★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	27957828		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Insufficiency	Renal Insufficiency	BEFREE	23129820		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	27957828		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	CTD_human_DG	17267746		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	22923027, 24934151, 31409409		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	CTD_human_DG	17267746		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	22923027, 24934151, 31409409		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	24934151, 31409409	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	22923027, 24934151, 31409409		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	32121248	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30569164, 31108850		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	19775692, 30569164, 31108850		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	20209122, 22558392, 31409409	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	22521321		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	20209122, 22558392, 22579530, 24186881		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	30569164		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	23147199		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	31394201		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	36426716	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	19775692		★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	23171931		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	23770786, 26786611	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	19666123, 22579530, 26786611		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	18508830	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	17933965		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	31763675		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	34872583	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	9371513		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	34283907	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	25236572, 31409409		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	31409409	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	25236572		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	20969748	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	29055959	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	25194333		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	22428028, 30538005		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24155659	Associate	★☆☆☆☆ Found in Text Mining only