CHST5 (carbohydrate sulfotransferase 5)

Gene

• Entrez ID: 23563
• Gene name: Carbohydrate sulfotransferase 5
• Gene symbol: CHST5
• Synonyms (NCBI Gene): I-GlcNAc-6-ST, I-GlcNAc6ST, glcNAc6ST-3, gn6st-3, hIGn6ST
• Chromosome: 16
• Chromosome location: 16q23.1
• Summary: The protein encoded by this gene belongs to the Gal/GalNAc/GlcNAc 6-O-sulfotransferase (GST) family, members of which catalyze the transfer of sulfate to position 6 of galactose (Gal), N-acetylgalactosamine (GalNAc), or N-acetylglucosamine (GlcNAc) residu

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT440945	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440945	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT1546436	hsa-miR-1234	CLIP-seq
MIRT1546437	hsa-miR-4438	CLIP-seq
MIRT1546438	hsa-miR-5095	CLIP-seq
MIRT1546439	hsa-miR-941	CLIP-seq
MIRT1546436	hsa-miR-1234	CLIP-seq
MIRT1964514	hsa-miR-4731-5p	CLIP-seq
MIRT1546438	hsa-miR-5095	CLIP-seq
MIRT1546439	hsa-miR-941	CLIP-seq
MIRT2200672	hsa-let-7a	CLIP-seq
MIRT2200673	hsa-let-7b	CLIP-seq
MIRT2200674	hsa-let-7c	CLIP-seq
MIRT2200675	hsa-let-7d	CLIP-seq
MIRT2200676	hsa-let-7e	CLIP-seq
MIRT2200677	hsa-let-7f	CLIP-seq
MIRT2200678	hsa-let-7g	CLIP-seq
MIRT2200679	hsa-let-7i	CLIP-seq
MIRT2200680	hsa-miR-1224-3p	CLIP-seq
MIRT1546436	hsa-miR-1234	CLIP-seq
MIRT2200681	hsa-miR-1260	CLIP-seq
MIRT2200682	hsa-miR-1260b	CLIP-seq
MIRT2200683	hsa-miR-1280	CLIP-seq
MIRT2200684	hsa-miR-150	CLIP-seq
MIRT2200685	hsa-miR-1539	CLIP-seq
MIRT2200686	hsa-miR-4458	CLIP-seq
MIRT2200687	hsa-miR-4500	CLIP-seq
MIRT2200688	hsa-miR-4688	CLIP-seq
MIRT2200689	hsa-miR-4713-5p	CLIP-seq
MIRT1546438	hsa-miR-5095	CLIP-seq
MIRT2200690	hsa-miR-532-3p	CLIP-seq
MIRT2200691	hsa-miR-562	CLIP-seq
MIRT1546439	hsa-miR-941	CLIP-seq
MIRT2200692	hsa-miR-98	CLIP-seq
MIRT2447047	hsa-miR-3127-5p	CLIP-seq
MIRT2447048	hsa-miR-4751	CLIP-seq
MIRT2503416	hsa-miR-4715-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	NAS	12855678
GO:0000139	Component	Golgi membrane	TAS
GO:0001517	Function	N-acetylglucosamine 6-O-sulfotransferase activity	IBA
GO:0001517	Function	N-acetylglucosamine 6-O-sulfotransferase activity	IDA	10491328
GO:0001517	Function	N-acetylglucosamine 6-O-sulfotransferase activity	IEA
GO:0001517	Function	N-acetylglucosamine 6-O-sulfotransferase activity	TAS
GO:0005794	Component	Golgi apparatus	IDA	12855678
GO:0005794	Component	Golgi apparatus	IEA
GO:0005802	Component	Trans-Golgi network	IBA
GO:0005975	Process	Carbohydrate metabolic process	IEA
GO:0006044	Process	N-acetylglucosamine metabolic process	IBA
GO:0006044	Process	N-acetylglucosamine metabolic process	IDA	10491328, 12218059
GO:0006044	Process	N-acetylglucosamine metabolic process	IEA
GO:0006477	Process	Protein sulfation	TAS	10491328
GO:0006790	Process	Sulfur compound metabolic process	IBA
GO:0006790	Process	Sulfur compound metabolic process	IDA	10491328
GO:0006790	Process	Sulfur compound metabolic process	IEA
GO:0008146	Function	Sulfotransferase activity	IEA
GO:0008146	Function	Sulfotransferase activity	TAS	10491328
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	10491328
GO:0016020	Component	Membrane	TAS	10491328
GO:0016740	Function	Transferase activity	IEA
GO:0018146	Process	Keratan sulfate proteoglycan biosynthetic process	IBA
GO:0018146	Process	Keratan sulfate proteoglycan biosynthetic process	TAS

Other IDs

• MIM: 604817
• HGNC: 1973
• e!Ensembl: ENSG00000135702

Protein

• UniProt ID: Q9GZS9
• Protein name: Carbohydrate sulfotransferase 5 (EC 2.8.2.-) (Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 4-alpha) (GST4-alpha) (Intestinal N-acetylglucosamine-6-O-sulfotransferase) (I-GlcNAc6ST) (Intestinal GlcNAc-6-sulfotransferase) (hIGn6ST)
• Protein function: Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues and O-linked sugars of mucin-type acceptors. Acts on
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00685	Sulfotransfer_1	62 → 379	Sulfotransferase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in small and large intestines and colon. Weakly expressed in lymphocytes. Not expressed in other tissues. Down-regulated in colonic adenocarcinomas. {ECO:0000269|PubMed:10491328, ECO:0000269|PubMed:11017086, ECO
• Sequence:

  MGMRARVPKVAHSTRRPPAARMWLPRFSSKTVTVLLLAQTTCLLLFIISRPGPSSPAGGE
  DRVHVLVLSSWRSGSSFLGQLFSQHPDVFYLMEPAWHVWTTLSQGSAATLHMAVRDLMRS
  IFLCDMDVFDAYMPQSRNLSAFFNWATSRALCSPPACSAFPRGTISKQDVCKTLCTRQPF
  SLAREACRSYSHVVLKEVRFFNLQVLYPLLSDPALNLRIVHLVRDPRAVLRSREAAGPIL
  ARDNGIVLGTNGKWVEADPHLRLIREVCRSHVRIAEAATLKPPPFLRGRYRLVRFEDLAR
  EPLAEIRALYAFTGLTLTPQLEAWIHNITHGSGIGKPIEAFHTSSRNARNVSQAWRHALP
  FTKILRVQEVCAGALQLLGYRPVYSADQQRDLTLDLVLPRGPDHFSWASPD

• Sequence length: 411

Pathways

Reactome:

Keratan sulfate biosynthesis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rieger anomaly	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	12107080		★☆☆☆☆ Found in Text Mining only