Gene Gene information from NCBI Gene database.
Entrez ID 23560
Gene name GTP binding protein 4
Gene symbol GTPBP4
Synonyms (NCBI Gene)
CRFGNGBNOG1
Chromosome 10
Chromosome location 10p15.3
Summary GTP-binding proteins are GTPases and function as molecular switches that can flip between two states: active, when GTP is bound, and inactive, when GDP is bound. `Active` in this context usually means that the molecule acts as a signal to trigger other ev
miRNA miRNA information provided by mirtarbase database.
264
miRTarBase ID miRNA Experiments Reference
MIRT019721 hsa-miR-375 Microarray 20215506
MIRT028964 hsa-miR-26b-5p Microarray 19088304
MIRT051261 hsa-miR-16-5p CLASH 23622248
MIRT038918 hsa-miR-92a-1-5p CLASH 23622248
MIRT718970 hsa-miR-6729-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
33
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0000463 Process Maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) IEA
GO:0001649 Process Osteoblast differentiation HDA 16210410
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003723 Function RNA binding IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
619169 21535 ENSG00000107937
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BZE4
Protein name GTP-binding protein 4 (Chronic renal failure gene protein) (GTP-binding protein NGB) (Nucleolar GTP-binding protein 1)
Protein function Involved in the biogenesis of the 60S ribosomal subunit (PubMed:32669547). Acts as a TP53 repressor, preventing TP53 stabilization and cell cycle arrest (PubMed:20308539).
PDB 6LSS , 6LU8 , 8FKP , 8FKQ , 8FKR , 8FKS , 8FKT , 8FKU , 8FKV , 8FKW , 8FKX , 8FKY , 8FKZ , 8FL0 , 8FL2 , 8FL3 , 8FL4 , 8FL6 , 8FL7 , 8FL9 , 8FLA , 8FLB , 8FLC , 8FLD , 8FLE , 8FLF , 8IDT , 8IDY , 8IE3 , 8INE , 8INF , 8INK , 8IPD , 8IPX , 8IPY , 8IR1 , 8IR3 , 8RL2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF17835 NOG1_N 6 165 NOG1 N-terminal helical domain Domain
PF06858 NOG1 235 292 Nucleolar GTP-binding protein 1 (NOG1) Family
PF08155 NOGCT 395 446 NOGCT (NUC087) domain Domain
Sequence
MAHYNFKKITVVPSAKDFIDLTLSKTQRKTPTVIHKHYQIHRIRHFYMRKVKFTQQNYHD
RLSQILTDFPKLDDIHPFYADLMNILYDKDHYKLALGQINIAKNLVDNVAKDYVRLMKYG
DSLYRCKQLKRAALGRMCTVIKRQKQSLEYLEQVRQHLSRLPTID
PNTRTLLLCGYPNVG
KSSFINKVTRADVDVQPYAFTTKSLFVGHMDYKYLRWQVVDTPGILDHPLEDRNTIEMQA
ITALAHLRAAVLYVMDLSEQCGHGLREQLELFQNIRPLFINKPLIVVANKCD
VKRIAELS
EDDQKIFTDLQSEGFPVIETSTLTEEGVIKVKTEACDRLLAHRVETKMKGNKVNEVLNRL
HLAIPTRRDDKERPPFIPEGVVARRKRMETEESRKKRERDLELEMGDDYILDLQKYWDLM
NLSEKHDKIPEIWEGHNIADYIDPAI
MKKLEELEKEEELRTAAGEYDSVSESEDEEMLEI
RQLAKQIREKKKLKILESKEKNTQGPRMPRTAKKVQRTVLEKEMRSLGVDMDDKDDAHYA
VQARRSRSITRKRKREDSAPPSSVARSGSCSRTPRDVSGLRDVKMVKKAKTMMKNAQKKM
NRLGKKGEADRHVFDMKPKHLLSGKRKAGKKDRR
Sequence length 634
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Ribosome biogenesis in eukaryotes  
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CHRONIC KIDNEY DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Carcinogenesis Carcinogenesis Pubtator 33134380 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 33204302, 33411682, 34783233, 36116159 Associate
★☆☆☆☆
Found in Text Mining only
Cleft Lip Cleft lip Pubtator 28662356 Associate
★☆☆☆☆
Found in Text Mining only
Cleft Palate Cleft palate Pubtator 27369588, 28662356 Associate
★☆☆☆☆
Found in Text Mining only
Colorectal Carcinoma Colorectal Cancer BEFREE 27720713
★☆☆☆☆
Found in Text Mining only
Deafness Deafness Pubtator 35248088 Associate
★☆☆☆☆
Found in Text Mining only
Hearing Loss Hearing loss Pubtator 35248088 Associate
★☆☆☆☆
Found in Text Mining only
Kidney Failure, Chronic Kidney Failure GWASCAT_DG 26831199
★☆☆☆☆
Found in Text Mining only
Liver carcinoma Liver carcinoma BEFREE 29212203
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of stomach Stomach Neoplasms BEFREE 29408813
★☆☆☆☆
Found in Text Mining only