Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	23555
Gene name	Tetraspanin 15
Gene symbol	TSPAN15
Synonyms (NCBI Gene)	2700063A19RikNET-7NET7TM4SF15
Chromosome	10
Chromosome location	10q22.1
Summary	The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate

136

Show/Hide all (136)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017890	hsa-miR-335-5p	Microarray	18185580
MIRT610442	hsa-miR-4307	HITS-CLIP	23824327
MIRT610442	hsa-miR-4307	HITS-CLIP	23824327
MIRT443282	hsa-miR-490-3p	PAR-CLIP	22100165
MIRT443281	hsa-miR-5197-3p	PAR-CLIP	22100165
MIRT443280	hsa-miR-3929	PAR-CLIP	22100165
MIRT443279	hsa-miR-4419b	PAR-CLIP	22100165
MIRT443278	hsa-miR-4478	PAR-CLIP	22100165
MIRT443277	hsa-miR-4251	PAR-CLIP	22100165
MIRT443276	hsa-miR-1253	PAR-CLIP	22100165
MIRT443275	hsa-miR-6770-5p	PAR-CLIP	22100165
MIRT443274	hsa-miR-485-5p	PAR-CLIP	22100165
MIRT443273	hsa-miR-6884-5p	PAR-CLIP	22100165
MIRT443271	hsa-miR-5189-3p	PAR-CLIP	22100165
MIRT610442	hsa-miR-4307	HITS-CLIP	23824327
MIRT610442	hsa-miR-4307	HITS-CLIP	23824327
MIRT443282	hsa-miR-490-3p	PAR-CLIP	22100165
MIRT443281	hsa-miR-5197-3p	PAR-CLIP	22100165
MIRT443280	hsa-miR-3929	PAR-CLIP	22100165
MIRT443279	hsa-miR-4419b	PAR-CLIP	22100165
MIRT443278	hsa-miR-4478	PAR-CLIP	22100165
MIRT443277	hsa-miR-4251	PAR-CLIP	22100165
MIRT443276	hsa-miR-1253	PAR-CLIP	22100165
MIRT443275	hsa-miR-6770-5p	PAR-CLIP	22100165
MIRT443274	hsa-miR-485-5p	PAR-CLIP	22100165
MIRT443273	hsa-miR-6884-5p	PAR-CLIP	22100165
MIRT443271	hsa-miR-5189-3p	PAR-CLIP	22100165
MIRT1459556	hsa-miR-1275	CLIP-seq
MIRT1459557	hsa-miR-146b-3p	CLIP-seq
MIRT1459558	hsa-miR-198	CLIP-seq
MIRT1459559	hsa-miR-2355-5p	CLIP-seq
MIRT1459560	hsa-miR-2467-3p	CLIP-seq
MIRT1459561	hsa-miR-31	CLIP-seq
MIRT1459562	hsa-miR-3136-5p	CLIP-seq
MIRT1459563	hsa-miR-3184	CLIP-seq
MIRT1459564	hsa-miR-3202	CLIP-seq
MIRT1459565	hsa-miR-339-5p	CLIP-seq
MIRT1459566	hsa-miR-3613-3p	CLIP-seq
MIRT1459567	hsa-miR-3617	CLIP-seq
MIRT1459568	hsa-miR-3659	CLIP-seq
MIRT1459569	hsa-miR-3662	CLIP-seq
MIRT1459570	hsa-miR-423-5p	CLIP-seq
MIRT1459571	hsa-miR-4265	CLIP-seq
MIRT1459572	hsa-miR-4271	CLIP-seq
MIRT1459573	hsa-miR-4296	CLIP-seq
MIRT1459574	hsa-miR-4322	CLIP-seq
MIRT1459575	hsa-miR-4323	CLIP-seq
MIRT1459576	hsa-miR-4417	CLIP-seq
MIRT1459577	hsa-miR-4439	CLIP-seq
MIRT1459578	hsa-miR-4513	CLIP-seq
MIRT1459579	hsa-miR-4525	CLIP-seq
MIRT1459580	hsa-miR-4633-3p	CLIP-seq
MIRT1459581	hsa-miR-4658	CLIP-seq
MIRT1459582	hsa-miR-4665-5p	CLIP-seq
MIRT1459583	hsa-miR-4706	CLIP-seq
MIRT1459584	hsa-miR-4723-5p	CLIP-seq
MIRT1459585	hsa-miR-4725-3p	CLIP-seq
MIRT1459586	hsa-miR-4733-5p	CLIP-seq
MIRT1459587	hsa-miR-4747-5p	CLIP-seq
MIRT1459588	hsa-miR-4749-5p	CLIP-seq
MIRT1459589	hsa-miR-4758-3p	CLIP-seq
MIRT1459590	hsa-miR-495	CLIP-seq
MIRT1459591	hsa-miR-574-5p	CLIP-seq
MIRT1459592	hsa-miR-582-3p	CLIP-seq
MIRT1459593	hsa-miR-625	CLIP-seq
MIRT1459594	hsa-miR-634	CLIP-seq
MIRT1459595	hsa-miR-641	CLIP-seq
MIRT1459596	hsa-miR-642a	CLIP-seq
MIRT1459597	hsa-miR-744	CLIP-seq
MIRT1459598	hsa-miR-938	CLIP-seq
MIRT1459599	hsa-miR-943	CLIP-seq
MIRT2137937	hsa-miR-1827	CLIP-seq
MIRT1459560	hsa-miR-2467-3p	CLIP-seq
MIRT2137938	hsa-miR-3150a-3p	CLIP-seq
MIRT2137939	hsa-miR-3175	CLIP-seq
MIRT2137940	hsa-miR-3194-3p	CLIP-seq
MIRT2137941	hsa-miR-3612	CLIP-seq
MIRT1459566	hsa-miR-3613-3p	CLIP-seq
MIRT2137942	hsa-miR-3646	CLIP-seq
MIRT1459569	hsa-miR-3662	CLIP-seq
MIRT2137943	hsa-miR-4275	CLIP-seq
MIRT2137944	hsa-miR-4292	CLIP-seq
MIRT2137945	hsa-miR-4308	CLIP-seq
MIRT2137946	hsa-miR-4667-5p	CLIP-seq
MIRT2137947	hsa-miR-4700-5p	CLIP-seq
MIRT1459594	hsa-miR-634	CLIP-seq
MIRT2137948	hsa-miR-650	CLIP-seq
MIRT2137949	hsa-miR-760	CLIP-seq
MIRT2137950	hsa-miR-767-3p	CLIP-seq
MIRT2137951	hsa-miR-939	CLIP-seq
MIRT1459556	hsa-miR-1275	CLIP-seq
MIRT2358846	hsa-miR-22	CLIP-seq
MIRT1459561	hsa-miR-31	CLIP-seq
MIRT2358847	hsa-miR-3153	CLIP-seq
MIRT2358848	hsa-miR-3180-5p	CLIP-seq
MIRT2358849	hsa-miR-3192	CLIP-seq
MIRT1459564	hsa-miR-3202	CLIP-seq
MIRT1459566	hsa-miR-3613-3p	CLIP-seq
MIRT1459567	hsa-miR-3617	CLIP-seq
MIRT1459569	hsa-miR-3662	CLIP-seq
MIRT2358850	hsa-miR-3689a-3p	CLIP-seq
MIRT2358851	hsa-miR-3689c	CLIP-seq
MIRT1459572	hsa-miR-4271	CLIP-seq
MIRT2358852	hsa-miR-4278	CLIP-seq
MIRT1459579	hsa-miR-4525	CLIP-seq
MIRT1459582	hsa-miR-4665-5p	CLIP-seq
MIRT1459584	hsa-miR-4723-5p	CLIP-seq
MIRT1459585	hsa-miR-4725-3p	CLIP-seq
MIRT2358853	hsa-miR-4728-5p	CLIP-seq
MIRT1459587	hsa-miR-4747-5p	CLIP-seq
MIRT2358854	hsa-miR-520a-5p	CLIP-seq
MIRT2358855	hsa-miR-525-5p	CLIP-seq
MIRT2358856	hsa-miR-542-5p	CLIP-seq
MIRT2358857	hsa-miR-558	CLIP-seq
MIRT1459592	hsa-miR-582-3p	CLIP-seq
MIRT1459593	hsa-miR-625	CLIP-seq
MIRT1459595	hsa-miR-641	CLIP-seq
MIRT2462497	hsa-miR-1470	CLIP-seq
MIRT2462498	hsa-miR-1976	CLIP-seq
MIRT1459559	hsa-miR-2355-5p	CLIP-seq
MIRT2462499	hsa-miR-4667-3p	CLIP-seq
MIRT2462500	hsa-miR-4722-3p	CLIP-seq
MIRT1459596	hsa-miR-642a	CLIP-seq
MIRT1459598	hsa-miR-938	CLIP-seq
MIRT1459567	hsa-miR-3617	CLIP-seq
MIRT1459583	hsa-miR-4706	CLIP-seq
MIRT1459588	hsa-miR-4749-5p	CLIP-seq
MIRT1459594	hsa-miR-634	CLIP-seq
MIRT1459595	hsa-miR-641	CLIP-seq
MIRT1459597	hsa-miR-744	CLIP-seq
MIRT1459567	hsa-miR-3617	CLIP-seq
MIRT1459583	hsa-miR-4706	CLIP-seq
MIRT1459588	hsa-miR-4749-5p	CLIP-seq
MIRT1459594	hsa-miR-634	CLIP-seq
MIRT1459595	hsa-miR-641	CLIP-seq
MIRT1459597	hsa-miR-744	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	23091066, 25416956, 26686862, 31792032, 32296183, 33961781, 34739841
GO:0005768	Component	Endosome	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	23091066, 30463011, 31792032
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0008593	Process	Regulation of Notch signaling pathway	IMP	23091066
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0019899	Function	Enzyme binding	IEA
GO:0019899	Function	Enzyme binding	IPI	23091066
GO:0030054	Component	Cell junction	IDA
GO:0031902	Component	Late endosome membrane	IEA
GO:0045746	Process	Negative regulation of Notch signaling pathway	IDA	30463011
GO:0051043	Process	Regulation of membrane protein ectodomain proteolysis	IDA	31792032, 34739841
GO:0051604	Process	Protein maturation	IDA	34739841
GO:0051604	Process	Protein maturation	IEA
GO:0051604	Process	Protein maturation	IMP	23091066
GO:0072659	Process	Protein localization to plasma membrane	IMP	23091066
GO:0097197	Component	Tetraspanin-enriched microdomain	IEA

MIM	HGNC	e!Ensembl
613140	23298	ENSG00000099282

O95858

Protein name

Tetraspanin-15 (Tspan-15) (Tetraspan NET-7) (Transmembrane 4 superfamily member 15)

Protein function

Part of TspanC8 subgroup, composed of 6 members that interact with the transmembrane metalloprotease ADAM10. This interaction is required for ADAM10 exit from the endoplasmic reticulum and for enzymatic maturation and trafficking to the cell sur

PDB

7RD5 , 7RDB , 8ESV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00335	Tetraspanin	20 → 258	Tetraspanin family	Family

Sequence

MPRGDSEQVRYCARFSYLWLKFSLIIYSTVFWLIGALVLSVGIYAEVERQKYKTLESAFL
APAIILILLGVVMFMVSFIGVLASLRDNLYLLQAFMYILGICLIMELIGGVVALTFRNQT
IDFLNDNIRRGIENYYDDLDFKNIMDFVQKKFKCCGGEDYRDWSKNQYHDCSAPGPLACG
VPYTCCIRNTTEVVNTMCGYKTIDKERFSVQDVIYVRGCTNAVIIWFMDNYTIMAGILLG
ILLPQFLGVLLTLLYITRVEDIIMEHSVTDGLLGPGAKPSVEAAGTGCCLCYPN

Sequence length

294

Interactions

View interactions

	Reactome
			Amyloid fiber formation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CHRONIC THROMBOEMBOLIC PULMONARY HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COR PULMONALE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (11)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	25772935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	GWASCAT_DG	26908601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	GWASCAT_DG	26908601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	GWASCAT_DG	26908601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31390680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	31390680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31390680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31390680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	31518558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29650964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	37371537	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TSPAN15 (tetraspanin 15)