Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	23552
Gene name	Cyclin dependent kinase 20
Gene symbol	CDK20
Synonyms (NCBI Gene)	CCRKCDCHP42PNQALRE
Chromosome	9
Chromosome location	9q22.1
Summary	The protein encoded by this gene contains a kinase domain most closely related to the cyclin-dependent protein kinases. The encoded kinase may activate cyclin-dependent kinase 2 and is involved in cell growth. Alternatively spliced transcript variants enc

Show/Hide all (2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs745561217	A>G	Likely-pathogenic	Missense variant, non coding transcript variant, coding sequence variant, intron variant
rs1057519438	C>G,T	Pathogenic	Intron variant, missense variant, coding sequence variant, stop gained, synonymous variant, non coding transcript variant

Show/Hide all (51)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017181	hsa-miR-335-5p	Microarray	18185580
MIRT039839	hsa-miR-615-3p	CLASH	23622248
MIRT880945	hsa-miR-450b-3p	CLIP-seq
MIRT880946	hsa-miR-4661-5p	CLIP-seq
MIRT880947	hsa-miR-769-3p	CLIP-seq
MIRT2500978	hsa-miR-1208	CLIP-seq
MIRT2500979	hsa-miR-1225-5p	CLIP-seq
MIRT2500980	hsa-miR-124	CLIP-seq
MIRT2500981	hsa-miR-1243	CLIP-seq
MIRT2500982	hsa-miR-1292	CLIP-seq
MIRT2500983	hsa-miR-1972	CLIP-seq
MIRT2500984	hsa-miR-199a-3p	CLIP-seq
MIRT2500985	hsa-miR-199b-3p	CLIP-seq
MIRT2500986	hsa-miR-2117	CLIP-seq
MIRT2500987	hsa-miR-3129-5p	CLIP-seq
MIRT2500988	hsa-miR-342-3p	CLIP-seq
MIRT2500989	hsa-miR-3622a-3p	CLIP-seq
MIRT2500990	hsa-miR-3622b-3p	CLIP-seq
MIRT2500991	hsa-miR-3652	CLIP-seq
MIRT2500992	hsa-miR-3670	CLIP-seq
MIRT2500993	hsa-miR-3714	CLIP-seq
MIRT2500994	hsa-miR-3910	CLIP-seq
MIRT2500995	hsa-miR-3921	CLIP-seq
MIRT2500996	hsa-miR-4251	CLIP-seq
MIRT2500997	hsa-miR-4255	CLIP-seq
MIRT2500998	hsa-miR-4273	CLIP-seq
MIRT2500999	hsa-miR-4279	CLIP-seq
MIRT2501000	hsa-miR-4284	CLIP-seq
MIRT2501001	hsa-miR-4329	CLIP-seq
MIRT2501002	hsa-miR-4430	CLIP-seq
MIRT2501003	hsa-miR-4471	CLIP-seq
MIRT2501004	hsa-miR-4505	CLIP-seq
MIRT2501005	hsa-miR-4539	CLIP-seq
MIRT2501006	hsa-miR-4646-5p	CLIP-seq
MIRT2501007	hsa-miR-4653-5p	CLIP-seq
MIRT2501008	hsa-miR-4724-5p	CLIP-seq
MIRT2501009	hsa-miR-4764-5p	CLIP-seq
MIRT2501010	hsa-miR-4786-5p	CLIP-seq
MIRT2501011	hsa-miR-506	CLIP-seq
MIRT2501012	hsa-miR-544b	CLIP-seq
MIRT2501013	hsa-miR-548aa	CLIP-seq
MIRT2501014	hsa-miR-548ag	CLIP-seq
MIRT2501015	hsa-miR-548ai	CLIP-seq
MIRT2501016	hsa-miR-580	CLIP-seq
MIRT2501017	hsa-miR-598	CLIP-seq
MIRT2501018	hsa-miR-647	CLIP-seq
MIRT2501019	hsa-miR-760	CLIP-seq
MIRT2501020	hsa-miR-767-3p	CLIP-seq
MIRT2501021	hsa-miR-885-3p	CLIP-seq
MIRT2501022	hsa-miR-922	CLIP-seq
MIRT2501023	hsa-miR-936	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
AR	Activation	21747169
AR	Activation	21747169

Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001843	Process	Neural tube closure	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	21986944, 26871637
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005929	Component	Cilium	IEA
GO:0008589	Process	Regulation of smoothened signaling pathway	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0021508	Process	Floor plate formation	IEA
GO:0031076	Process	Embryonic camera-type eye development	IEA
GO:0042995	Component	Cell projection	IEA
GO:0045879	Process	Negative regulation of smoothened signaling pathway	IEA
GO:0048706	Process	Embryonic skeletal system development	IEA
GO:0051301	Process	Cell division	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0060021	Process	Roof of mouth development	IEA
GO:0061512	Process	Protein localization to cilium	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1903317	Process	Regulation of protein maturation	IEA
GO:1990403	Process	Embryonic brain development	IEA

MIM	HGNC	e!Ensembl
610076	21420	ENSG00000156345

Q8IZL9

Protein name

Cyclin-dependent kinase 20 (EC 2.7.11.22) (CDK-activating kinase p42) (CAK-kinase p42) (Cell cycle-related kinase) (Cell division protein kinase 20) (Cyclin-dependent protein kinase H) (Cyclin-kinase-activating kinase p42)

Protein function

Required for high-level Shh responses in the developing neural tube. Together with TBC1D32, controls the structure of the primary cilium by coordinating assembly of the ciliary membrane and axoneme, allowing GLI2 to be properly activated in resp

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	4 → 288	Protein kinase domain	Domain

Sequence

MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMED
NQYVVQLKAVFPHGGGFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVAFCHA
NNIVHRDLKPANLLISASGQLKIADFGLARVFSPDGSRLYTHQVATRWYRAPELLYGARQ
YDQGVDLWSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKI
SFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAASKALLHQYFFTAPLPAHPSEL
PIPQRLGGPAPKAHPGPPHIHDFHVDRPLEESLLNPELIRPFILEG

Sequence length

346

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (18)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Attention deficit hyperactivity disorder	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
CDK20-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLEX NEURODEVELOPMENTAL DISORDER	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Compulsive behaviors	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Global developmental delay	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Hearing impairment	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Hereditary breast ovarian cancer syndrome	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual disability	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrotic syndrome	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE COMPULSIVE BEHAVIOR	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seizure	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (32)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	26397153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic Autoimmune	Autoimmune hemolytic anemia	Pubtator	2179128	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia, Spinocerebellar	Spinocerebellar Ataxia	BEFREE	23861941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	CLINVAR_DG			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Brain Infarction	Brain Infarction	BEFREE	31137455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23380370, 9729531, 9813039	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15365563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15040022	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28534518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	GENOMICS_ENGLAND_DG	29773874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	10097131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	15365563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	17565152, 23743448, 26081906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	17565152, 23743448, 26081906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	CLINVAR_DG			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Hashimoto Disease	Hashimoto disease	Pubtator	37545519	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	23861941, 26984770, 29860423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	23468892	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	37532789	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	26996668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28939663, 31086087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28534518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22307076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28534518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23468892	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obsessive compulsive behavior	Obsessive-Compulsive Disorder	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	Pubtator	24391455, 32665038	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	15969750	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	37545519	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	22307076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18787043	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19331166	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CDK20 (cyclin dependent kinase 20)