Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	23531
Gene name	Monocyte to macrophage differentiation associated
Gene symbol	MMD
Synonyms (NCBI Gene)	MMAMMD1PAQR11
Chromosome	17
Chromosome location	17q22
Summary	This protein is expressed by in vitro differentiated macrophages but not freshly isolated monocytes. Although sequence analysis identifies seven potential transmembrane domains, this protein has little homology to G-protein receptors and it has not been p

315

Show/Hide all (315)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002814	hsa-miR-1-3p	Microarray	15685193
MIRT017756	hsa-miR-335-5p	Microarray	18185580
MIRT002814	hsa-miR-1-3p	Microarray	18668037
MIRT002814	hsa-miR-1-3p	Microarray	15685193
MIRT029369	hsa-miR-26b-5p	Microarray	19088304
MIRT438745	hsa-miR-140-5p	Luciferase reporter assay	24971538
MIRT438745	hsa-miR-140-5p	Luciferase reporter assay	24971538
MIRT438745	hsa-miR-140-5p	Luciferase reporter assay	24971538
MIRT438745	hsa-miR-140-5p	Luciferase reporter assay	24971538
MIRT724475	hsa-miR-302a-5p	HITS-CLIP	19536157
MIRT724474	hsa-miR-4778-3p	HITS-CLIP	19536157
MIRT724473	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT724472	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT724471	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT440226	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT440225	hsa-miR-205-5p	HITS-CLIP	22473208
MIRT440226	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT440225	hsa-miR-205-5p	HITS-CLIP	22473208
MIRT438745	hsa-miR-140-5p	Luciferase reporter assayMicroarray	26175215
MIRT724475	hsa-miR-302a-5p	HITS-CLIP	19536157
MIRT724474	hsa-miR-4778-3p	HITS-CLIP	19536157
MIRT724473	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT724472	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT724471	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT1152919	hsa-miR-1	CLIP-seq
MIRT1152920	hsa-miR-1257	CLIP-seq
MIRT1152921	hsa-miR-1270	CLIP-seq
MIRT1152922	hsa-miR-1282	CLIP-seq
MIRT1152923	hsa-miR-136	CLIP-seq
MIRT1152924	hsa-miR-137	CLIP-seq
MIRT1152925	hsa-miR-154	CLIP-seq
MIRT1152926	hsa-miR-15a	CLIP-seq
MIRT1152927	hsa-miR-15b	CLIP-seq
MIRT1152928	hsa-miR-16	CLIP-seq
MIRT1152929	hsa-miR-195	CLIP-seq
MIRT1152930	hsa-miR-200b	CLIP-seq
MIRT1152931	hsa-miR-200c	CLIP-seq
MIRT1152932	hsa-miR-202	CLIP-seq
MIRT1152933	hsa-miR-203	CLIP-seq
MIRT1152934	hsa-miR-206	CLIP-seq
MIRT1152935	hsa-miR-25	CLIP-seq
MIRT1152936	hsa-miR-3136-5p	CLIP-seq
MIRT1152937	hsa-miR-3153	CLIP-seq
MIRT1152938	hsa-miR-3190	CLIP-seq
MIRT1152939	hsa-miR-32	CLIP-seq
MIRT1152940	hsa-miR-3606	CLIP-seq
MIRT1152941	hsa-miR-361-5p	CLIP-seq
MIRT1152942	hsa-miR-363	CLIP-seq
MIRT1152943	hsa-miR-367	CLIP-seq
MIRT1152944	hsa-miR-3673	CLIP-seq
MIRT1152945	hsa-miR-369-3p	CLIP-seq
MIRT1152946	hsa-miR-375	CLIP-seq
MIRT1152947	hsa-miR-409-3p	CLIP-seq
MIRT1152948	hsa-miR-424	CLIP-seq
MIRT1152949	hsa-miR-4275	CLIP-seq
MIRT1152950	hsa-miR-4282	CLIP-seq
MIRT1152951	hsa-miR-429	CLIP-seq
MIRT1152952	hsa-miR-4325	CLIP-seq
MIRT1152953	hsa-miR-4327	CLIP-seq
MIRT1152954	hsa-miR-4434	CLIP-seq
MIRT1152955	hsa-miR-4439	CLIP-seq
MIRT1152956	hsa-miR-4452	CLIP-seq
MIRT1152957	hsa-miR-4464	CLIP-seq
MIRT1152958	hsa-miR-4490	CLIP-seq
MIRT1152959	hsa-miR-4516	CLIP-seq
MIRT1152960	hsa-miR-4531	CLIP-seq
MIRT1152961	hsa-miR-4668-5p	CLIP-seq
MIRT1152962	hsa-miR-4680-3p	CLIP-seq
MIRT1152963	hsa-miR-4720-3p	CLIP-seq
MIRT1152964	hsa-miR-4742-5p	CLIP-seq
MIRT1152965	hsa-miR-4748	CLIP-seq
MIRT1152966	hsa-miR-4752	CLIP-seq
MIRT1152967	hsa-miR-4790-3p	CLIP-seq
MIRT1152968	hsa-miR-4804-3p	CLIP-seq
MIRT1152969	hsa-miR-497	CLIP-seq
MIRT1152970	hsa-miR-513a-3p	CLIP-seq
MIRT1152971	hsa-miR-515-5p	CLIP-seq
MIRT1152972	hsa-miR-548a-3p	CLIP-seq
MIRT1152973	hsa-miR-548a-5p	CLIP-seq
MIRT1152974	hsa-miR-548ab	CLIP-seq
MIRT1152975	hsa-miR-548ak	CLIP-seq
MIRT1152976	hsa-miR-548b-5p	CLIP-seq
MIRT1152977	hsa-miR-548c-5p	CLIP-seq
MIRT1152978	hsa-miR-548d-5p	CLIP-seq
MIRT1152979	hsa-miR-548e	CLIP-seq
MIRT1152980	hsa-miR-548f	CLIP-seq
MIRT1152981	hsa-miR-548h	CLIP-seq
MIRT1152982	hsa-miR-548i	CLIP-seq
MIRT1152983	hsa-miR-548j	CLIP-seq
MIRT1152984	hsa-miR-548w	CLIP-seq
MIRT1152985	hsa-miR-548y	CLIP-seq
MIRT1152986	hsa-miR-559	CLIP-seq
MIRT1152987	hsa-miR-587	CLIP-seq
MIRT1152988	hsa-miR-613	CLIP-seq
MIRT1152989	hsa-miR-620	CLIP-seq
MIRT1152990	hsa-miR-759	CLIP-seq
MIRT1152991	hsa-miR-92a	CLIP-seq
MIRT1152992	hsa-miR-92b	CLIP-seq
MIRT1152993	hsa-miR-943	CLIP-seq
MIRT1152919	hsa-miR-1	CLIP-seq
MIRT1152922	hsa-miR-1282	CLIP-seq
MIRT1152932	hsa-miR-202	CLIP-seq
MIRT1152934	hsa-miR-206	CLIP-seq
MIRT1152938	hsa-miR-3190	CLIP-seq
MIRT1152941	hsa-miR-361-5p	CLIP-seq
MIRT1152944	hsa-miR-3673	CLIP-seq
MIRT1152946	hsa-miR-375	CLIP-seq
MIRT1152947	hsa-miR-409-3p	CLIP-seq
MIRT1152966	hsa-miR-4752	CLIP-seq
MIRT1152988	hsa-miR-613	CLIP-seq
MIRT2043741	hsa-miR-128	CLIP-seq
MIRT2043742	hsa-miR-27a	CLIP-seq
MIRT2043743	hsa-miR-27b	CLIP-seq
MIRT2043744	hsa-miR-30a	CLIP-seq
MIRT2043745	hsa-miR-30b	CLIP-seq
MIRT2043746	hsa-miR-30c	CLIP-seq
MIRT2043747	hsa-miR-30d	CLIP-seq
MIRT2043748	hsa-miR-30e	CLIP-seq
MIRT2043749	hsa-miR-3180-5p	CLIP-seq
MIRT2043750	hsa-miR-3187-3p	CLIP-seq
MIRT2043751	hsa-miR-34c-3p	CLIP-seq
MIRT2043752	hsa-miR-4435	CLIP-seq
MIRT2043753	hsa-miR-4694-5p	CLIP-seq
MIRT2043754	hsa-miR-4701-5p	CLIP-seq
MIRT2043755	hsa-miR-4715-5p	CLIP-seq
MIRT2043756	hsa-miR-513a-5p	CLIP-seq
MIRT2043757	hsa-miR-548s	CLIP-seq
MIRT2043758	hsa-miR-588	CLIP-seq
MIRT1152990	hsa-miR-759	CLIP-seq
MIRT1152919	hsa-miR-1	CLIP-seq
MIRT2273172	hsa-miR-1178	CLIP-seq
MIRT2273173	hsa-miR-1208	CLIP-seq
MIRT2273174	hsa-miR-1224-5p	CLIP-seq
MIRT2273175	hsa-miR-1225-5p	CLIP-seq
MIRT1152922	hsa-miR-1282	CLIP-seq
MIRT2273176	hsa-miR-150	CLIP-seq
MIRT1152925	hsa-miR-154	CLIP-seq
MIRT2273177	hsa-miR-155	CLIP-seq
MIRT1152926	hsa-miR-15a	CLIP-seq
MIRT1152927	hsa-miR-15b	CLIP-seq
MIRT1152928	hsa-miR-16	CLIP-seq
MIRT2273178	hsa-miR-1914	CLIP-seq
MIRT1152929	hsa-miR-195	CLIP-seq
MIRT2273179	hsa-miR-19a	CLIP-seq
MIRT2273180	hsa-miR-19b	CLIP-seq
MIRT1152930	hsa-miR-200b	CLIP-seq
MIRT1152931	hsa-miR-200c	CLIP-seq
MIRT1152932	hsa-miR-202	CLIP-seq
MIRT2273181	hsa-miR-205	CLIP-seq
MIRT2273182	hsa-miR-2054	CLIP-seq
MIRT1152934	hsa-miR-206	CLIP-seq
MIRT2273183	hsa-miR-3074-3p	CLIP-seq
MIRT2043744	hsa-miR-30a	CLIP-seq
MIRT2043745	hsa-miR-30b	CLIP-seq
MIRT2043746	hsa-miR-30c	CLIP-seq
MIRT2043747	hsa-miR-30d	CLIP-seq
MIRT2043748	hsa-miR-30e	CLIP-seq
MIRT2273184	hsa-miR-3120-3p	CLIP-seq
MIRT2273185	hsa-miR-3124-3p	CLIP-seq
MIRT1152936	hsa-miR-3136-5p	CLIP-seq
MIRT2273186	hsa-miR-3148	CLIP-seq
MIRT2043749	hsa-miR-3180-5p	CLIP-seq
MIRT2043750	hsa-miR-3187-3p	CLIP-seq
MIRT1152938	hsa-miR-3190	CLIP-seq
MIRT2273187	hsa-miR-330-3p	CLIP-seq
MIRT2273188	hsa-miR-338-3p	CLIP-seq
MIRT2273189	hsa-miR-339-5p	CLIP-seq
MIRT2043751	hsa-miR-34c-3p	CLIP-seq
MIRT1152941	hsa-miR-361-5p	CLIP-seq
MIRT1152944	hsa-miR-3673	CLIP-seq
MIRT2273190	hsa-miR-3681	CLIP-seq
MIRT2273191	hsa-miR-3691-3p	CLIP-seq
MIRT1152945	hsa-miR-369-3p	CLIP-seq
MIRT2273192	hsa-miR-374c	CLIP-seq
MIRT1152946	hsa-miR-375	CLIP-seq
MIRT2273193	hsa-miR-383	CLIP-seq
MIRT2273194	hsa-miR-3926	CLIP-seq
MIRT2273195	hsa-miR-3978	CLIP-seq
MIRT1152947	hsa-miR-409-3p	CLIP-seq
MIRT2273196	hsa-miR-410	CLIP-seq
MIRT1152948	hsa-miR-424	CLIP-seq
MIRT2273197	hsa-miR-4261	CLIP-seq
MIRT1152949	hsa-miR-4275	CLIP-seq
MIRT1152950	hsa-miR-4282	CLIP-seq
MIRT2273198	hsa-miR-4286	CLIP-seq
MIRT1152951	hsa-miR-429	CLIP-seq
MIRT2273199	hsa-miR-433	CLIP-seq
MIRT2273200	hsa-miR-4433	CLIP-seq
MIRT2043752	hsa-miR-4435	CLIP-seq
MIRT2273201	hsa-miR-4436b-5p	CLIP-seq
MIRT1152955	hsa-miR-4439	CLIP-seq
MIRT2273202	hsa-miR-4446-5p	CLIP-seq
MIRT1152956	hsa-miR-4452	CLIP-seq
MIRT2273203	hsa-miR-4459	CLIP-seq
MIRT2273204	hsa-miR-4480	CLIP-seq
MIRT1152958	hsa-miR-4490	CLIP-seq
MIRT2273205	hsa-miR-4496	CLIP-seq
MIRT2273206	hsa-miR-4529-5p	CLIP-seq
MIRT2273207	hsa-miR-4530	CLIP-seq
MIRT2273208	hsa-miR-4672	CLIP-seq
MIRT1152962	hsa-miR-4680-3p	CLIP-seq
MIRT2273209	hsa-miR-4690-3p	CLIP-seq
MIRT2043753	hsa-miR-4694-5p	CLIP-seq
MIRT2043754	hsa-miR-4701-5p	CLIP-seq
MIRT2043755	hsa-miR-4715-5p	CLIP-seq
MIRT2273210	hsa-miR-4729	CLIP-seq
MIRT1152964	hsa-miR-4742-5p	CLIP-seq
MIRT2273211	hsa-miR-4751	CLIP-seq
MIRT1152966	hsa-miR-4752	CLIP-seq
MIRT2273212	hsa-miR-4755-5p	CLIP-seq
MIRT2273213	hsa-miR-4760-3p	CLIP-seq
MIRT2273214	hsa-miR-4768-3p	CLIP-seq
MIRT2273215	hsa-miR-4772-5p	CLIP-seq
MIRT2273216	hsa-miR-483-3p	CLIP-seq
MIRT2273217	hsa-miR-490-5p	CLIP-seq
MIRT1152969	hsa-miR-497	CLIP-seq
MIRT1152970	hsa-miR-513a-3p	CLIP-seq
MIRT1152972	hsa-miR-548a-3p	CLIP-seq
MIRT1152979	hsa-miR-548e	CLIP-seq
MIRT1152980	hsa-miR-548f	CLIP-seq
MIRT2043757	hsa-miR-548s	CLIP-seq
MIRT2273218	hsa-miR-561	CLIP-seq
MIRT2273219	hsa-miR-579	CLIP-seq
MIRT1152987	hsa-miR-587	CLIP-seq
MIRT2043758	hsa-miR-588	CLIP-seq
MIRT1152988	hsa-miR-613	CLIP-seq
MIRT2273220	hsa-miR-655	CLIP-seq
MIRT2273221	hsa-miR-659	CLIP-seq
MIRT2273222	hsa-miR-670	CLIP-seq
MIRT1152990	hsa-miR-759	CLIP-seq
MIRT2273223	hsa-miR-767-3p	CLIP-seq
MIRT2273224	hsa-miR-885-5p	CLIP-seq
MIRT2273225	hsa-miR-922	CLIP-seq
MIRT1152993	hsa-miR-943	CLIP-seq
MIRT2273181	hsa-miR-205	CLIP-seq
MIRT2043744	hsa-miR-30a	CLIP-seq
MIRT2043745	hsa-miR-30b	CLIP-seq
MIRT2043746	hsa-miR-30c	CLIP-seq
MIRT2043747	hsa-miR-30d	CLIP-seq
MIRT2043748	hsa-miR-30e	CLIP-seq
MIRT2043750	hsa-miR-3187-3p	CLIP-seq
MIRT2273194	hsa-miR-3926	CLIP-seq
MIRT2273199	hsa-miR-433	CLIP-seq
MIRT2043752	hsa-miR-4435	CLIP-seq
MIRT2273204	hsa-miR-4480	CLIP-seq
MIRT2043754	hsa-miR-4701-5p	CLIP-seq
MIRT2043755	hsa-miR-4715-5p	CLIP-seq
MIRT1152963	hsa-miR-4720-3p	CLIP-seq
MIRT1152968	hsa-miR-4804-3p	CLIP-seq
MIRT1152972	hsa-miR-548a-3p	CLIP-seq
MIRT1152979	hsa-miR-548e	CLIP-seq
MIRT1152980	hsa-miR-548f	CLIP-seq
MIRT2043757	hsa-miR-548s	CLIP-seq
MIRT2043758	hsa-miR-588	CLIP-seq
MIRT1152990	hsa-miR-759	CLIP-seq
MIRT2273175	hsa-miR-1225-5p	CLIP-seq
MIRT2043741	hsa-miR-128	CLIP-seq
MIRT2438617	hsa-miR-142-5p	CLIP-seq
MIRT2043742	hsa-miR-27a	CLIP-seq
MIRT2043743	hsa-miR-27b	CLIP-seq
MIRT2438618	hsa-miR-3182	CLIP-seq
MIRT2438619	hsa-miR-3200-3p	CLIP-seq
MIRT2438620	hsa-miR-320a	CLIP-seq
MIRT2438621	hsa-miR-320b	CLIP-seq
MIRT2438622	hsa-miR-320c	CLIP-seq
MIRT2438623	hsa-miR-320d	CLIP-seq
MIRT2438624	hsa-miR-338-5p	CLIP-seq
MIRT2438625	hsa-miR-340	CLIP-seq
MIRT2043751	hsa-miR-34c-3p	CLIP-seq
MIRT2438626	hsa-miR-4272	CLIP-seq
MIRT2438627	hsa-miR-4429	CLIP-seq
MIRT2438628	hsa-miR-4504	CLIP-seq
MIRT2438629	hsa-miR-4652-3p	CLIP-seq
MIRT2043753	hsa-miR-4694-5p	CLIP-seq
MIRT1152964	hsa-miR-4742-5p	CLIP-seq
MIRT2438630	hsa-miR-4764-3p	CLIP-seq
MIRT2438631	hsa-miR-4774-3p	CLIP-seq
MIRT2043756	hsa-miR-513a-5p	CLIP-seq
MIRT2438632	hsa-miR-545	CLIP-seq
MIRT2273221	hsa-miR-659	CLIP-seq
MIRT2438633	hsa-miR-944	CLIP-seq
MIRT2454266	hsa-miR-3123	CLIP-seq
MIRT2454267	hsa-miR-3688-5p	CLIP-seq
MIRT2454268	hsa-miR-3910	CLIP-seq
MIRT2454269	hsa-miR-3925-5p	CLIP-seq
MIRT2454270	hsa-miR-3976	CLIP-seq
MIRT2454271	hsa-miR-4470	CLIP-seq
MIRT2454272	hsa-miR-548an	CLIP-seq
MIRT2438617	hsa-miR-142-5p	CLIP-seq
MIRT2438620	hsa-miR-320a	CLIP-seq
MIRT2438621	hsa-miR-320b	CLIP-seq
MIRT2438622	hsa-miR-320c	CLIP-seq
MIRT2438623	hsa-miR-320d	CLIP-seq
MIRT2438624	hsa-miR-338-5p	CLIP-seq
MIRT2438625	hsa-miR-340	CLIP-seq
MIRT2438627	hsa-miR-4429	CLIP-seq
MIRT2438628	hsa-miR-4504	CLIP-seq
MIRT2273172	hsa-miR-1178	CLIP-seq
MIRT2273173	hsa-miR-1208	CLIP-seq
MIRT2438617	hsa-miR-142-5p	CLIP-seq
MIRT2438620	hsa-miR-320a	CLIP-seq
MIRT2438621	hsa-miR-320b	CLIP-seq
MIRT2438622	hsa-miR-320c	CLIP-seq
MIRT2438623	hsa-miR-320d	CLIP-seq
MIRT2438624	hsa-miR-338-5p	CLIP-seq
MIRT2438625	hsa-miR-340	CLIP-seq
MIRT2685092	hsa-miR-3646	CLIP-seq
MIRT2685093	hsa-miR-3684	CLIP-seq
MIRT2685094	hsa-miR-411	CLIP-seq
MIRT2438627	hsa-miR-4429	CLIP-seq
MIRT2438628	hsa-miR-4504	CLIP-seq
MIRT2685095	hsa-miR-4645-3p	CLIP-seq
MIRT1152964	hsa-miR-4742-5p	CLIP-seq
MIRT2685096	hsa-miR-548c-3p	CLIP-seq
MIRT2273223	hsa-miR-767-3p	CLIP-seq

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004672	Function	Protein kinase activity	IDA	21968647
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005768	Component	Endosome	IEA
GO:0005794	Component	Golgi apparatus	IDA	21968647
GO:0005886	Component	Plasma membrane	TAS	7503749
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	7503749
GO:0031902	Component	Late endosome membrane	IEA
GO:0032880	Process	Regulation of protein localization	IDA	21968647
GO:0038023	Function	Signaling receptor activity	TAS	7503749
GO:0045666	Process	Positive regulation of neuron differentiation	IDA	21968647
GO:0045860	Process	Positive regulation of protein kinase activity	IDA	21968647
GO:0140911	Function	Pore-forming activity	IEA

MIM	HGNC	e!Ensembl
604467	7153	ENSG00000108960

Q15546

Protein name

Monocyte to macrophage differentiation factor (Progestin and adipoQ receptor family member 11) (Progestin and adipoQ receptor family member XI)

Protein function

Involved in the dynamics of lysosomal membranes associated with microglial activation following brain lesion.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03006	HlyIII	24 → 220	Haemolysin-III related	Family

Tissue specificity

TISSUE SPECIFICITY: Exhibits relatively ubiquitous expression with preferential expression in mature (in vitro differentiated) macrophages. {ECO:0000269|PubMed:16044242}.

Sequence

MRFKNRFQRFMNHRAPANGRYKPTCYEHAANCYTHAFLIVPAIVGSALLHRLSDDCWEKI
TAWIYGMGLCALFIVSTVFHIVSWKKSHLRTVEHCFHMCDRMVIYFFIAASYAPWLNLRE
LGPLASHMRWFIWLMAAGGTIYVFLYHEKYKVVELFFYLTMGFSPALVVTSMNNTDGLQE
LACGGLIYCLGVVFFKSDGIIPFAHAIWHLFVATAAAVHYYAIWKYLYRSPTDFMRHL

Sequence length

238

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (42)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anemia	Anemia	BEFREE	27131640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29567577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	33851416	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29567577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	27557380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24971538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic interstitial nephritis	Interstitial Nephritis	BEFREE	30973671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25339833	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	19283448, 19409525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	33750834	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	30949461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	39735537	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	19283448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	17173945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	27131640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	19409525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	30973671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	27557380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24971538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21642943, 23353816, 24091636, 29550343, 30413811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	30973671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	30674285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya Disease	BEFREE	19409525, 28109734, 29567577, 31812345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya disease 1	Moyamoya disease	BEFREE	19409525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophies, Limb-Girdle	Limb-Girdle Muscular Dystrophy	BEFREE	25176504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	21642943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	BEFREE	31046780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23052202, 24971538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	30887907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	29873257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23870818, 24971538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	28780990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Neuropathy	Optic Neuropathy	BEFREE	31269850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scott Syndrome	Scott Syndrome	BEFREE	21642943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	17548696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	31331855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	23870818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	31812345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	17134727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	19409525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin B 12 Deficiency	Cobalamin deficiency	BEFREE	19283448, 27131640, 29454538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma pigmentosum, group A	Xeroderma Pigmentosum	BEFREE	18085531		★★★★★ ★☆☆☆☆ Found in Text Mining only

MMD (monocyte to macrophage differentiation associated)