CLCF1 (cardiotrophin like cytokine factor 1)

Gene

• Entrez ID: 23529
• Gene name: Cardiotrophin like cytokine factor 1
• Gene symbol: CLCF1
• Synonyms (NCBI Gene): BSF-3, BSF3, CISS2, CLC, NNT-1, NNT1, NR6
• Chromosome: 11
• Chromosome location: 11q13.2
• Summary: This gene is a member of the glycoprotein (gp)130 cytokine family and encodes cardiotrophin-like cytokine factor 1 (CLCF1). CLCF1 forms a heterodimer complex with cytokine receptor-like factor 1 (CRLF1). This dimer competes with ciliary neurotrophic facto

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT440940	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440940	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT894535	hsa-miR-1293	CLIP-seq
MIRT894536	hsa-miR-3151	CLIP-seq
MIRT894537	hsa-miR-3158-3p	CLIP-seq
MIRT894538	hsa-miR-412	CLIP-seq
MIRT894539	hsa-miR-4481	CLIP-seq
MIRT894540	hsa-miR-4483	CLIP-seq
MIRT894541	hsa-miR-4693-3p	CLIP-seq
MIRT894542	hsa-miR-4745-5p	CLIP-seq
MIRT894543	hsa-miR-4758-5p	CLIP-seq
MIRT894544	hsa-miR-486-3p	CLIP-seq
MIRT894545	hsa-miR-603	CLIP-seq
MIRT1965277	hsa-miR-1207-5p	CLIP-seq
MIRT1965278	hsa-miR-1236	CLIP-seq
MIRT894535	hsa-miR-1293	CLIP-seq
MIRT1965279	hsa-miR-1914	CLIP-seq
MIRT1965280	hsa-miR-2053	CLIP-seq
MIRT1965281	hsa-miR-218	CLIP-seq
MIRT1965282	hsa-miR-299-5p	CLIP-seq
MIRT894536	hsa-miR-3151	CLIP-seq
MIRT1965283	hsa-miR-3160-5p	CLIP-seq
MIRT1965284	hsa-miR-3166	CLIP-seq
MIRT1965285	hsa-miR-3918	CLIP-seq
MIRT1965286	hsa-miR-4283	CLIP-seq
MIRT1965287	hsa-miR-4436b-3p	CLIP-seq
MIRT894539	hsa-miR-4481	CLIP-seq
MIRT894540	hsa-miR-4483	CLIP-seq
MIRT1965288	hsa-miR-4489	CLIP-seq
MIRT1965289	hsa-miR-4492	CLIP-seq
MIRT1965290	hsa-miR-4498	CLIP-seq
MIRT1965291	hsa-miR-4505	CLIP-seq
MIRT1965292	hsa-miR-4512	CLIP-seq
MIRT1965293	hsa-miR-4731-5p	CLIP-seq
MIRT894542	hsa-miR-4745-5p	CLIP-seq
MIRT1965294	hsa-miR-4753-3p	CLIP-seq
MIRT1965295	hsa-miR-4761-3p	CLIP-seq
MIRT1965296	hsa-miR-4763-3p	CLIP-seq
MIRT1965297	hsa-miR-4768-5p	CLIP-seq
MIRT1965298	hsa-miR-4771	CLIP-seq
MIRT894544	hsa-miR-486-3p	CLIP-seq
MIRT1965299	hsa-miR-569	CLIP-seq
MIRT894545	hsa-miR-603	CLIP-seq
MIRT1965300	hsa-miR-636	CLIP-seq
MIRT1965301	hsa-miR-637	CLIP-seq
MIRT1965302	hsa-miR-762	CLIP-seq
MIRT1965277	hsa-miR-1207-5p	CLIP-seq
MIRT894535	hsa-miR-1293	CLIP-seq
MIRT2201219	hsa-miR-2110	CLIP-seq
MIRT2201220	hsa-miR-22	CLIP-seq
MIRT2201221	hsa-miR-3150a-3p	CLIP-seq
MIRT894536	hsa-miR-3151	CLIP-seq
MIRT894537	hsa-miR-3158-3p	CLIP-seq
MIRT2201222	hsa-miR-3175	CLIP-seq
MIRT2201223	hsa-miR-3189-3p	CLIP-seq
MIRT1965285	hsa-miR-3918	CLIP-seq
MIRT894538	hsa-miR-412	CLIP-seq
MIRT1965286	hsa-miR-4283	CLIP-seq
MIRT2201224	hsa-miR-4300	CLIP-seq
MIRT894540	hsa-miR-4483	CLIP-seq
MIRT1965288	hsa-miR-4489	CLIP-seq
MIRT1965289	hsa-miR-4492	CLIP-seq
MIRT1965290	hsa-miR-4498	CLIP-seq
MIRT1965291	hsa-miR-4505	CLIP-seq
MIRT1965292	hsa-miR-4512	CLIP-seq
MIRT2201225	hsa-miR-4715-3p	CLIP-seq
MIRT1965293	hsa-miR-4731-5p	CLIP-seq
MIRT1965296	hsa-miR-4763-3p	CLIP-seq
MIRT894544	hsa-miR-486-3p	CLIP-seq
MIRT2201226	hsa-miR-548an	CLIP-seq
MIRT2201227	hsa-miR-558	CLIP-seq
MIRT1965301	hsa-miR-637	CLIP-seq
MIRT1965302	hsa-miR-762	CLIP-seq
MIRT2201228	hsa-miR-920	CLIP-seq
MIRT2201229	hsa-miR-939	CLIP-seq
MIRT894535	hsa-miR-1293	CLIP-seq
MIRT894536	hsa-miR-3151	CLIP-seq
MIRT1965286	hsa-miR-4283	CLIP-seq
MIRT894540	hsa-miR-4483	CLIP-seq
MIRT1965288	hsa-miR-4489	CLIP-seq
MIRT894535	hsa-miR-1293	CLIP-seq
MIRT894540	hsa-miR-4483	CLIP-seq
MIRT1965291	hsa-miR-4505	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002639	Process	Positive regulation of immunoglobulin production	IEA
GO:0002639	Process	Positive regulation of immunoglobulin production	ISS
GO:0005102	Function	Signaling receptor binding	IPI	15272019
GO:0005125	Function	Cytokine activity	IDA	10966616
GO:0005125	Function	Cytokine activity	IEA
GO:0005125	Function	Cytokine activity	NAS	10500198
GO:0005127	Function	Ciliary neurotrophic factor receptor binding	IDA	10966616
GO:0005127	Function	Ciliary neurotrophic factor receptor binding	IDA	11285233
GO:0005515	Function	Protein binding	IPI	10966616, 26858303, 29507344
GO:0005576	Component	Extracellular region	IBA
GO:0005576	Component	Extracellular region	IDA	10966616
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	10448081
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	ISS
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IBA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IEA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	ISS
GO:0008083	Function	Growth factor activity	TAS	14632778
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	10966616, 11285233
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	NAS	10500198
GO:0030183	Process	B cell differentiation	IEA
GO:0030183	Process	B cell differentiation	ISS
GO:0030890	Process	Positive regulation of B cell proliferation	IBA
GO:0030890	Process	Positive regulation of B cell proliferation	IEA
GO:0030890	Process	Positive regulation of B cell proliferation	ISS
GO:0043524	Process	Negative regulation of neuron apoptotic process	IDA	10966616, 11285233
GO:0048018	Function	Receptor ligand activity	IEA
GO:0048295	Process	Positive regulation of isotype switching to IgE isotypes	IEA
GO:0048295	Process	Positive regulation of isotype switching to IgE isotypes	ISS
GO:0048711	Process	Positive regulation of astrocyte differentiation	IEA
GO:0048711	Process	Positive regulation of astrocyte differentiation	ISS
GO:0097058	Component	CRLF-CLCF1 complex	IBA
GO:0097058	Component	CRLF-CLCF1 complex	IDA	10966616
GO:0097059	Component	CNTFR-CLCF1 complex	IBA
GO:0097059	Component	CNTFR-CLCF1 complex	IDA	11285233
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	IDA	10966616, 11285233
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	IEA
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	TAS	14632778

Other IDs

• MIM: 607672
• HGNC: 17412
• e!Ensembl: ENSG00000175505

Protein

• UniProt ID: Q9UBD9
• Protein name: Cardiotrophin-like cytokine factor 1 (B-cell-stimulating factor 3) (BSF-3) (Novel neurotrophin-1) (NNT-1)
• Protein function: In complex with CRLF1, forms a heterodimeric neurotropic cytokine that plays a crucial role during neuronal development (Probable). Also stimulates B-cells. Binds to and activates the ILST/gp130 receptor. {ECO:0000269|PubMed:10448081, ECO:000026
• PDB: 8D7H, 8D7R
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF06875	PRF	40 → 213	Plethodontid receptivity factor PRF	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed predominantly in lymph nodes, spleen, peripheral blood lymphocytes, bone marrow, and fetal liver. {ECO:0000269|PubMed:10448081, ECO:0000269|PubMed:10500198}.
• Sequence:

  MDLRAGDSWGMLACLCTVLWHLPAVPALNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGT
  YLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGL
  NRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQ
  KMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF

• Sequence length: 225

Pathways

KEGG:

Cytokine-cytokine receptor interaction
JAK-STAT signaling pathway

Reactome:

IL-6-type cytokine receptor ligand interactions

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Cold-induced sweating syndrome 2	Pathogenic	rs104894198, rs104894203, rs137853934, rs137853935	RCV000003064 RCV000003065 RCV000020692 RCV000032768	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CLCF1-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLD-INDUCED SWEATING SYNDROME	—	GWAS catalog, Orphanet GWAS catalog, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLD-INDUCED SWEATING SYNDROME 1	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRISPONI SYNDROME	—	CTD, Disgenet, Orphanet CTD, Disgenet, Orphanet CTD, Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRISPONI/COLD-INDUCED SWEATING SYNDROME 2	—	HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
2-3 toe syndactyly	Syndactyly Of The Toes	HPO_DG			★☆☆☆☆ Found in Text Mining only
Acquired cubitus valgus	Cubitus valgus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	27903646		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31700175		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	25654358		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	27903646		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	19650845, 30368403		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	28489587		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30209193		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	30682452, 31123109, 31157540		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	31903716, 32277847, 36835202, 38551536	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30209193		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	31552057		★☆☆☆☆ Found in Text Mining only
Bartter Disease	Bartter syndrome	BEFREE	10864591, 12761627, 15709978		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	37102643	Associate	★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	37454491	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	31248987		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	33430863	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	33430863	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	LHGDN	17166282		★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	17166282	Associate	★☆☆☆☆ Found in Text Mining only
Byzanthine arch palate	High palate	HPO_DG			★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	19758173		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	27903646		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	29754498, 29961347		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	28322448		★☆☆☆☆ Found in Text Mining only
Clinodactyly	Clinodactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Clinodactyly of fingers	Clinodactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cold-induced sweating syndrome	Cold-Induced Sweating Syndrome	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLD-INDUCED SWEATING SYNDROME 1	Cold-Induced Sweating Syndrome	ORPHANET_DG	1678282, 20400119		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLD-INDUCED SWEATING SYNDROME 1	Cold-Induced Sweating Syndrome	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLD-INDUCED SWEATING SYNDROME 2	Cold-Induced Sweating Syndrome	UNIPROT_DG	16782820		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
COLD-INDUCED SWEATING SYNDROME 2	Cold-Induced Sweating Syndrome	CTD_human_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
COLD-INDUCED SWEATING SYNDROME 2	Cold-Induced Sweating Syndrome	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Colitis	Colitis	Pubtator	35085569	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	23388545, 25654358, 37891214	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21716316		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27182161	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	36361563	Associate	★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	28322448, 31128376		★☆☆☆☆ Found in Text Mining only
Crisponi syndrome	Crisponi Syndrome	ORPHANET_DG	1678282, 20400119		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crisponi syndrome	Crisponi Syndrome	BEFREE	20400119		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crisponi syndrome	Crisponi Syndrome	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crisponi syndrome	Crisponi syndrome	Pubtator	32512309	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crisponi syndrome	Crisponi Syndrome	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crisponi syndrome	Crisponi Syndrome	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	37891214	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	19921088		★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	28194801		★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	32197970, 39343172	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	15709978		★☆☆☆☆ Found in Text Mining only
Facial paralysis	Facial paralysis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Generalized Myotonia of Thomsen	Congenital myotonia	BEFREE	10864591		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	12843258, 35265072	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	31129471		★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	33750029	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	33750029	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	26991533		★☆☆☆☆ Found in Text Mining only
Hypohidrosis	Hypohidrosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Idiopathic hypercalciuria	Hypercalciuria	BEFREE	9519207		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	30239701		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	HPO_DG			★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	LHGDN	16015083		★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	11826292, 15709978		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	11053039		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	12031912		★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	26013830		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22846364, 23640968, 26198769, 28489587		★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Microscopic Polyangiitis	Microscopic polyangiitis	Pubtator	23690996, 28569178	Associate	★☆☆☆☆ Found in Text Mining only
Microstomia	Microstomia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	14632778	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	27387891		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	27387891	Associate	★☆☆☆☆ Found in Text Mining only
Myotonia Congenita	Myotonia Congenita	BEFREE	10864591		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	28322448		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	28322448	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	31438994		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31309731, 31700175		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	11826292, 15709978		★☆☆☆☆ Found in Text Mining only
Osteopetrosis	Osteopetrosis	BEFREE	15709978		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	31248987, 9519207		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	33430863	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	28028720		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	30073123		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	40133927	Stimulate	★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	22654612	Associate	★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sensorimotor neuropathy	Sensorimotor neuropathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	31309731		★☆☆☆☆ Found in Text Mining only
Thoracolumbar scoliosis	Thoracolumbar scoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	33750029	Stimulate	★☆☆☆☆ Found in Text Mining only