CABIN1 (calcineurin binding protein 1)

Gene

• Entrez ID: 23523
• Gene name: Calcineurin binding protein 1
• Gene symbol: CABIN1
• Synonyms (NCBI Gene): CAIN, KB-318B8.7, PPP3IN
• Chromosome: 22
• Chromosome location: 22q11.23
• Summary: Calcineurin plays an important role in the T-cell receptor-mediated signal transduction pathway. The protein encoded by this gene binds specifically to the activated form of calcineurin and inhibits calcineurin-mediated signal transduction. The encoded pr

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT051340	hsa-miR-15a-5p	CLASH	23622248
MIRT051109	hsa-miR-16-5p	CLASH	23622248
MIRT051109	hsa-miR-16-5p	CLASH	23622248
MIRT050262	hsa-miR-25-3p	CLASH	23622248
MIRT044682	hsa-miR-320a	CLASH	23622248
MIRT043612	hsa-miR-151a-3p	CLASH	23622248
MIRT036421	hsa-miR-1226-3p	CLASH	23622248
MIRT856970	hsa-miR-1285	CLIP-seq
MIRT856971	hsa-miR-147	CLIP-seq
MIRT856972	hsa-miR-1587	CLIP-seq
MIRT856973	hsa-miR-3150a-3p	CLIP-seq
MIRT856974	hsa-miR-3150b-3p	CLIP-seq
MIRT856975	hsa-miR-3151	CLIP-seq
MIRT856976	hsa-miR-3175	CLIP-seq
MIRT856977	hsa-miR-3187-5p	CLIP-seq
MIRT856978	hsa-miR-3605-5p	CLIP-seq
MIRT856979	hsa-miR-3689d	CLIP-seq
MIRT856980	hsa-miR-3911	CLIP-seq
MIRT856981	hsa-miR-4417	CLIP-seq
MIRT856982	hsa-miR-4447	CLIP-seq
MIRT856983	hsa-miR-4472	CLIP-seq
MIRT856984	hsa-miR-4488	CLIP-seq
MIRT856985	hsa-miR-4492	CLIP-seq
MIRT856986	hsa-miR-4498	CLIP-seq
MIRT856987	hsa-miR-4505	CLIP-seq
MIRT856988	hsa-miR-4642	CLIP-seq
MIRT856989	hsa-miR-4650-5p	CLIP-seq
MIRT856990	hsa-miR-4656	CLIP-seq
MIRT856991	hsa-miR-4659a-5p	CLIP-seq
MIRT856992	hsa-miR-4659b-5p	CLIP-seq
MIRT856993	hsa-miR-4675	CLIP-seq
MIRT856994	hsa-miR-4689	CLIP-seq
MIRT856995	hsa-miR-4697-5p	CLIP-seq
MIRT856996	hsa-miR-4716-5p	CLIP-seq
MIRT856997	hsa-miR-4741	CLIP-seq
MIRT856998	hsa-miR-4784	CLIP-seq
MIRT856999	hsa-miR-491-5p	CLIP-seq
MIRT857000	hsa-miR-541	CLIP-seq
MIRT857001	hsa-miR-612	CLIP-seq
MIRT857002	hsa-miR-637	CLIP-seq
MIRT857003	hsa-miR-644	CLIP-seq
MIRT857004	hsa-miR-654-5p	CLIP-seq
MIRT857005	hsa-miR-661	CLIP-seq
MIRT857006	hsa-miR-762	CLIP-seq
MIRT857007	hsa-miR-939	CLIP-seq
MIRT1954492	hsa-miR-1207-3p	CLIP-seq
MIRT1954493	hsa-miR-3165	CLIP-seq
MIRT1954494	hsa-miR-3201	CLIP-seq
MIRT1954495	hsa-miR-4265	CLIP-seq
MIRT1954496	hsa-miR-4296	CLIP-seq
MIRT1954497	hsa-miR-4322	CLIP-seq
MIRT856981	hsa-miR-4417	CLIP-seq
MIRT1954498	hsa-miR-4435	CLIP-seq
MIRT1954499	hsa-miR-4455	CLIP-seq
MIRT1954500	hsa-miR-4651	CLIP-seq
MIRT1954501	hsa-miR-4791	CLIP-seq
MIRT1954502	hsa-miR-608	CLIP-seq
MIRT1954503	hsa-miR-609	CLIP-seq
MIRT1954492	hsa-miR-1207-3p	CLIP-seq
MIRT1954493	hsa-miR-3165	CLIP-seq
MIRT1954494	hsa-miR-3201	CLIP-seq
MIRT2192119	hsa-miR-376a	CLIP-seq
MIRT2192120	hsa-miR-376b	CLIP-seq
MIRT1954495	hsa-miR-4265	CLIP-seq
MIRT1954496	hsa-miR-4296	CLIP-seq
MIRT1954497	hsa-miR-4322	CLIP-seq
MIRT856981	hsa-miR-4417	CLIP-seq
MIRT1954498	hsa-miR-4435	CLIP-seq
MIRT1954499	hsa-miR-4455	CLIP-seq
MIRT2192121	hsa-miR-4632	CLIP-seq
MIRT1954500	hsa-miR-4651	CLIP-seq
MIRT1954501	hsa-miR-4791	CLIP-seq
MIRT2192122	hsa-miR-505	CLIP-seq
MIRT2192123	hsa-miR-520d-5p	CLIP-seq
MIRT2192124	hsa-miR-524-5p	CLIP-seq
MIRT1954502	hsa-miR-608	CLIP-seq
MIRT1954503	hsa-miR-609	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NR3C2	Repression	22345406

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004864	Function	Protein phosphatase inhibitor activity	NAS	9655484
GO:0005515	Function	Protein binding	IPI	12700764, 28514442, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0006325	Process	Chromatin organization	IEA
GO:0006334	Process	Nucleosome assembly	IDA	14718166
GO:0007166	Process	Cell surface receptor signaling pathway	NAS	9655484
GO:0016235	Component	Aggresome	IDA
GO:0031491	Function	Nucleosome binding	IBA

Other IDs

• MIM: 604251
• HGNC: 24187
• e!Ensembl: ENSG00000099991

Protein

• UniProt ID: Q9Y6J0
• Protein name: Calcineurin-binding protein cabin-1 (Calcineurin inhibitor) (CAIN)
• Protein function: May be required for replication-independent chromatin assembly. May serve as a negative regulator of T-cell receptor (TCR) signaling via inhibition of calcineurin. Inhibition of activated calcineurin is dependent on both PKC and calcium signals.
• PDB: 1N6J
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF09047	MEF2_binding	2156 → 2190	MEF2 binding	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed in different tissues. {ECO:0000269|PubMed:9655484}.
• Sequence:

  MIRIAALNASSTIEDDHEGSFKSHKTQTKEAQEAEAFALYHKALDLQKHDRFEESAKAYH
  ELLEASLLREAVSSGDEKEGLKHPGLILKYSTYKNLAQLAAQREDLETAMEFYLEAVMLD
  STDVNLWYKIGHVALRLIRIPLARHAFEEGLRCNPDHWPCLDNLITVLYTLSDYTTCLYF
  ICKALEKDCRYSKGLVLKEKIFEEQPCLRKDSLRMFLKCDMSIHDVSVSAAETQAIVDEA
  LGLRKKRQALIVREKEPDLKLVQPIPFFTWKCLGESLLAMYNHLTTCEPPRPSLGKRIDL
  SDYQDPSQPLESSMVVTPVNVIQPSTVSTNPAVAVAEPVVSYTSVATTSFPLHSPGLLET
  GAPVGDISGGDKSKKGVKRKKISEESGETAKRRSARVRNTKCKKEEKVDFQELLMKFLPS
  RLRKLDPEEEDDSFNNYEVQSEAKLESFPSIGPQRLSFDSATFMESEKQDVHEFLLENLT
  NGGILELMMRYLKAMGHKFLVRWPPGLAEVVLSVYHSWRRHSTSLPNPLLRDCSNKHIKD
  MMLMSLSCMELQLDQWLLTKGRSSAVSPRNCPAGMVNGRFGPDFPGTHCLGDLLQLSFAS
  SQRDLFEDGWLEFVVRVYWLKARFLALQGDMEQALENYDICTEMLQSSTAIQVEAGAERR
  DIVIRLPNLHNDSVVSLEEIDKNLKSLERCQSLEEIQRLYEAGDYKAVVHLLRPTLCTSG
  FDRAKHLEFMTSIPERPAQLLLLQDSLLRLKDYRQCFECSDVALNEAVQQMVNSGEAAAK
  EEWVATVTQLLMGIEQALSADSSGSILKVSSSTTGLVRLTNNLIQVIDCSMAVQEEAKEP
  HVSSVLPWIILHRIIWQEEDTFHSLCHQQQLQNPAEEGMSETPMLPSSLMLLNTAHEYLG
  RRSWCCNSDGALLRFYVRVLQKELAASTSEDTHPYKEELETALEQCFYCLYSFPSKKSKA
  RYLEEHSAQQVDLIWEDALFMFEYFKPKTLPEFDSYKTSTVSADLANLLKRIATIVPRTE
  RPALSLDKVSAYIEGTSTEVPCLPEGADPSPPVVNELYYLLADYHFKNKEQSKAIKFYMH
  DICICPNRFDSWAGMALARASRIQDKLNSNELKSDGPIWKHATPVLNCFRRALEIDSSNL
  SLWIEYGTMSYALHSFASRQLKQWRGELPPELVQQMEGRRDSMLETAKHCFTSAARCEGD
  GDEEEWLIHYMLGKVAEKQQQPPTVYLLHYRQAGHYLHEEAARYPKKIHYHNPPELAMEA
  LEVYFRLHASILKLLGKPDSGVGAEVLVNFMKEAAEGPFARGEEKNTPKASEKEKACLVD
  EDSHSSAGTLPGPGASLPSSSGPGLTSPPYTATPIDHDYVKCKKPHQQATPDDRSQDSTA
  VALSDSSSTQDFFNEPTSLLEGSRKSYTEKRLPILSSQAGATGKDLQGATEERGKNEESL
  ESTEGFRAAEQGVQKPAAETPASACIPGKPSASTPTLWDGKKRGDLPGEPVAFPQGLPAG
  AEEQRQFLTEQCIASFRLCLSRFPQHYKSLYRLAFLYTYSKTHRNLQWARDVLLGSSIPW
  QQLQHMPAQGLFCERNKTNFFNGIWRIPVDEIDRPGSFAWHMNRSIVLLLKVLAQLRDHS
  TLLKVSSMLQRTPDQGKKYLRDADRQVLAQRAFILTVKVLEDTLSELAEGSERPGPKVCG
  LPGARMTTDVSHKASPEDGQEGLPQPKKPPLADGSGPGPEPGGKVGLLNHRPVAMDAGDS
  ADQSGERKDKESPRAGPTEPMDTSEATVCHSDLERTPPLLPGRPARDRGPESRPTELSLE
  ELSISARQQPTPLTPAQPAPAPAPATTTGTRAGGHPEEPLSRLSRKRKLLEDTESGKTLL
  LDAYRVWQQGQKGVAYDLGRVERIMSETYMLIKQVDEEAALEQAVKFCQVHLGAAAQRQA
  SGDTPTTPKHPKDSRENFFPVTVVPTAPDPVPADSVQRPSDAHTKPRPALAAATTIITCP
  PSASASTLDQSKDPGPPRPHRPEATPSMASLGPEGEELARVAEGTSFPPQEPRHSPQVKM
  APTSSPAEPHCWPAEAALGTGAEPTCSQEGKLRPEPRRDGEAQEAASETQPLSSPPTAAS
  SKAPSSGSAQPPEGHPGKPEPSRAKSRPLPNMPKLVIPSAATKFPPEITVTPPTPTLLSP
  KGSISEETKQKLKSAILSAQSAANVRKESLCQPALEVLETSSQESSLESETDEDDDYMDI
  

• Sequence length: 2220

Pathways

Reactome:

Formation of Senescence-Associated Heterochromatin Foci (SAHF)

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CABIN1-related disorder	Benign; Uncertain significance; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EXOSTOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROFIBROMATOSIS	—	GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Kidney Tubular Necrosis	Renal tubular necrosis	BEFREE	30630071		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	28225510, 29642214		★☆☆☆☆ Found in Text Mining only
AICARDI-GOUTIERES SYNDROME	Aicardi Goutieres Syndrome	BEFREE	29869293		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	28233655		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	23624525		★☆☆☆☆ Found in Text Mining only
Angioedemas Hereditary	Angioedema	Pubtator	23257211	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	22175542		★☆☆☆☆ Found in Text Mining only
Atypical Hemolytic Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	29157988		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	20571464		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29304536		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21673995		★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	30348935		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	38179759	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	29309836		★☆☆☆☆ Found in Text Mining only
Catatonia	Catatonia	BEFREE	30150606		★☆☆☆☆ Found in Text Mining only
Central Diabetes Insipidus	Diabetes Insipidus	BEFREE	31332916		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	23257211, 28603715		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	27642059, 29162680, 29194767		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	17953459, 18769365, 25014506, 29300232		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Insufficiency	Renal Insufficiency	BEFREE	17953459		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	28382751		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19016304	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	20514436		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28724911		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	29751166		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	31472262		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30150606		★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	BEFREE	20090409		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	19409888, 21707760, 28069324, 31053034		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	28225510, 29642214		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	20099993, 25162201		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	20099993, 25162201, 29642214		★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	BEFREE	29981217		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	19409888, 21707760, 28069324, 31053034		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	30414316, 31421950		★☆☆☆☆ Found in Text Mining only
Gitelman Syndrome	Gitelman Syndrome	BEFREE	30201548		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	30156148		★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	19717467, 26130705, 27269951, 28017734, 28108270, 28417553, 28578010, 28606176, 29032272, 29155316, 29432302, 29794073, 30055353, 30153491, 30194027, 30375493, 30414316, 30630534, 30723110, 31158502, 31201170, 31595800, 31678538, 31715305		★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	30403433		★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome, Familial	Guillain-Barre Syndrome	BEFREE	30403433		★☆☆☆☆ Found in Text Mining only
Hepatic Veno-Occlusive Disease	Hepatic veno-occlusive disease-immunodeficiency syndrome	BEFREE	27427915		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	21445698		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	20099993, 21963515, 27402766, 27982677, 28584011, 29133357, 31296221		★☆☆☆☆ Found in Text Mining only
Hypopigmentation disorder	Hypopigmentation Disorder	BEFREE	28120351		★☆☆☆☆ Found in Text Mining only
Idiopathic Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	23739238, 28314744		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	28255003, 29540152		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29375315		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	28791279		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	26634693, 29179182, 29619905, 29946864, 31049814, 31772699		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	40254362	Inhibit	★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	20099993, 30615259		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	27776444		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	27642059, 29162680, 29194767		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	21886838	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30989721		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	28382751		★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	28225510, 31375890		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	28476075		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	30406967		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	30207816, 30420324, 31767117		★☆☆☆☆ Found in Text Mining only
Malignant Hypertension	Malignant Hypertension	BEFREE	31733722		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21673995		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	28724911		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	29057176, 30016177		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28302995, 29479631, 29802791, 30528864, 31146812		★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	29155318		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30150606		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	29399181		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	28017734		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	30218287		★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	29642214		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23752066, 30989721		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	22419362, 30360670, 31455257		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome, Minimal Change	Nephrotic Syndrome	BEFREE	23739238, 28314744		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	30457174		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28299629		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	16287142		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	18757082	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	36217215	Stimulate	★☆☆☆☆ Found in Text Mining only
Pericardial effusion	Pericardial effusion	BEFREE	29058031		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	28225510		★☆☆☆☆ Found in Text Mining only
Posterior reversible encephalopathy syndrome	Leukoencephalopathy	BEFREE	28417553, 28602890, 31421950		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	31472262		★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	30232548	Associate	★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	28724911		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28724911		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	22568654, 23256706, 31335763		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	22322241, 28915690, 30720681		★☆☆☆☆ Found in Text Mining only
Renal tubular disorder	Renal Tubular Disorder	BEFREE	24833766		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	20080907		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20075944		★☆☆☆☆ Found in Text Mining only
Schwannomatosis	Schwannomatosis	BEFREE	16287142		★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	29802791		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	30913205		★☆☆☆☆ Found in Text Mining only
Spondylo-ocular syndrome	Spondyloocular Syndrome	BEFREE	27427915		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30016177		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	30016177, 30228949		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	29358156, 29375315		★☆☆☆☆ Found in Text Mining only
Steroid resistant nephrotic syndrome of childhood	Steroid resistant nephrotic syndrome	BEFREE	31049814		★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	28934936		★☆☆☆☆ Found in Text Mining only
Thrombotic Microangiopathies	Thrombotic Microangiopathies	BEFREE	23635876, 29155318, 31733722		★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	28366923		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	29751166, 30213584, 30353757, 30980713		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	30348935, 30354362		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	30801528		★☆☆☆☆ Found in Text Mining only