Gene Gene information from NCBI Gene database.
Entrez ID 23512
Gene name SUZ12 polycomb repressive complex 2 subunit
Gene symbol SUZ12
Synonyms (NCBI Gene)
CHET9IMMASJJAZ1
Chromosome 17
Chromosome location 17q11.2
Summary This zinc finger gene has been identified at the breakpoints of a recurrent chromosomal translocation reported in endometrial stromal sarcoma. Recombination of these breakpoints results in the fusion of this gene and JAZF1. The protein encoded by this gen
SNPs SNP information provided by dbSNP.
8
SNP ID Visualize variation Clinical significance Consequence
rs771704089 C>T Pathogenic Stop gained, non coding transcript variant, coding sequence variant
rs1131692177 A>T Pathogenic Coding sequence variant, non coding transcript variant, missense variant
rs1242271427 G>A Pathogenic Splice donor variant
rs1567840381 A>C Uncertain-significance, pathogenic Non coding transcript variant, coding sequence variant, missense variant
rs1567840389 ->G Pathogenic Frameshift variant, non coding transcript variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
395
miRTarBase ID miRNA Experiments Reference
MIRT004084 hsa-miR-101-3p Western blot 19008416
MIRT007118 hsa-miR-19a-3p Luciferase reporter assay 23451058
MIRT019780 hsa-miR-375 Microarray 20215506
MIRT020638 hsa-miR-155-5p Proteomics 18668040
MIRT021690 hsa-miR-138-5p Western blot;qRT-PCR 21770894
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
39
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0001222 Function Transcription corepressor binding IPI 29628311
GO:0001739 Component Sex chromatin IEA
GO:0003682 Function Chromatin binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606245 17101 ENSG00000178691
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q15022
Protein name Polycomb protein SUZ12 (Chromatin precipitated E2F target 9 protein) (ChET 9 protein) (Joined to JAZF1 protein) (Suppressor of zeste 12 protein homolog)
Protein function Polycomb group (PcG) protein. Component of the PRC2 complex, which methylates 'Lys-9' (H3K9me) and 'Lys-27' (H3K27me) of histone H3, leading to transcriptional repression of the affected target gene (PubMed:15225548, PubMed:15231737, PubMed:1538
PDB 4W2R , 5HYN , 5IJ7 , 5IJ8 , 5LS6 , 5WAI , 5WAK , 5WG6 , 6B3W , 6C23 , 6C24 , 6NQ3 , 6WKR , 7AT8 , 7KSO , 7KSR , 7KTP , 7TD5 , 8EQV , 8FYH , 8T9G , 8TAS , 8TB9 , 8VMI , 8VML , 8VNV , 8VNZ , 9C8U , 9DCH
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09733 VEFS-Box 546 680 VEFS-Box of polycomb protein Family
Tissue specificity TISSUE SPECIFICITY: Overexpressed in breast and colon cancer. {ECO:0000269|PubMed:15231737, ECO:0000269|PubMed:15684044}.
Sequence
MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSA
AAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQIYRFLRTRNLIAPIFLHRTLTYMSH
RNSRTNIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQN
SVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPS
NSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEELPARRKRNREDGEKTFVAQMT
VFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLR
WTGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPN
ENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVY
HPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASM
SEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQI
EEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHL
VSMHDFNLISIMSIDKAVTK
LREMQQKLEKGESASPANEEITEEQNGTANGFSEINSKEK
ALETDSVSGVSKQSKKQKL
Sequence length 739
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Polycomb repressive complex   PRC2 methylates histones and DNA
Oxidative Stress Induced Senescence
PKMTs methylate histone lysines
SUMOylation of chromatin organization proteins
Regulation of PTEN gene transcription
Transcriptional Regulation by E2F6
HCMV Early Events
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
18
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Acute megakaryoblastic leukemia in down syndrome Likely pathogenic; Pathogenic rs1909527513 RCV001293761
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Imagawa-Matsumoto syndrome Likely pathogenic; Pathogenic rs2142215876, rs2142222219, rs2142215091, rs2142222377, rs2142117453, rs2508662320, rs2508677290, rs2508661900, rs2508684640, rs1131692177, rs1598143986, rs1598174225, rs1598192095, rs771704089, rs1909936773
View all (1 more)
RCV001375951
RCV005635141
RCV001808266
RCV002249186
RCV002246753
View all (11 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Non-immune hydrops fetalis Likely pathogenic rs2142215876 RCV002285026
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
SUZ12-related disorder Likely pathogenic; Pathogenic rs372162318 RCV003419132
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ALZHEIMER DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DEVELOPMENTAL DISABILITIES Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Developmental disorder Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASMS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute Promyelocytic Leukemia Promyelocytic Leukemia BEFREE 21480320
★☆☆☆☆
Found in Text Mining only
Adenoma Adenoma CTD_human_DG 25119042
★☆☆☆☆
Found in Text Mining only
Adenoma, Basal Cell Adenoma CTD_human_DG 25119042
★☆☆☆☆
Found in Text Mining only
Adenoma, Microcystic Adenoma CTD_human_DG 25119042
★☆☆☆☆
Found in Text Mining only
Adenoma, Monomorphic Adenoma CTD_human_DG 25119042
★☆☆☆☆
Found in Text Mining only
Adenoma, Trabecular Adenoma CTD_human_DG 25119042
★☆☆☆☆
Found in Text Mining only
Anaplasia Anaplasia BEFREE 30291346
★☆☆☆☆
Found in Text Mining only
Anemia Aplastic Aplastic anemia Pubtator 33166403 Associate
★☆☆☆☆
Found in Text Mining only
Bladder Neoplasm Bladder Neoplasm BEFREE 24449823, 26268246
★☆☆☆☆
Found in Text Mining only
Blast Phase Blast phase chronic myelogenous leukemia BEFREE 26017281
★☆☆☆☆
Found in Text Mining only