Gene Gene information from NCBI Gene database.
Entrez ID 23508
Gene name Tetratricopeptide repeat domain 9
Gene symbol TTC9
Synonyms (NCBI Gene)
TTC9A
Chromosome 14
Chromosome location 14q24.2
Summary This gene encodes a protein that contains three tetratricopeptide repeats. The gene has been shown to be hormonally regulated in breast cancer cells and may play a role in cancer cell invasion and metastasis. [provided by RefSeq, Mar 2009]
miRNA miRNA information provided by mirtarbase database.
379
miRTarBase ID miRNA Experiments Reference
MIRT242205 hsa-miR-302d-3p PAR-CLIP 21572407
MIRT242204 hsa-miR-302c-3p PAR-CLIP 21572407
MIRT242210 hsa-miR-520e PAR-CLIP 21572407
MIRT242218 hsa-miR-520d-3p PAR-CLIP 21572407
MIRT242201 hsa-miR-302a-3p PAR-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
GO ID Ontology Definition Evidence Reference
GO:0060348 Process Bone development IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
610488 20267 ENSG00000133985
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q92623
Protein name Tetratricopeptide repeat protein 9A (TPR repeat protein 9A)
Family and domains
Sequence
MERKGSAAGAKGNPSPPAAGEGQRPPPPLCVPGGGGGAPARGQVGAAAEPAELIRRAHEF
KSQGAQCYKDKKFREAIGKYHRALLELKGLLPPPGERERDSRPASPAGALKPGRLSEEQS
KTVEAIEIDCYNSLAACLLQAELVNYERVKEYCLKVLKKEGENFKALYRSGVAFYHLGDY
DKALYYLKEARTQQPTDTNVIRYIQLTEMKLSRCSQREKEAM
Sequence length 222
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
SARCOPENIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Hypoalphalipoproteinemias Hypoalphalipoproteinemia Pubtator 32541515 Associate
★☆☆☆☆
Found in Text Mining only
Nasopharyngeal Carcinoma Nasopharyngeal carcinoma Pubtator 32541515 Associate
★☆☆☆☆
Found in Text Mining only