Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	23504
Gene name	RIMS binding protein 2
Gene symbol	RIMBP2
Synonyms (NCBI Gene)	PPP1R133RBP2RIM-BP2
Chromosome	12
Chromosome location	12q24.33

131

Show/Hide all (131)

miRTarBase ID	miRNA	Experiments	Reference
MIRT724868	hsa-miR-330-3p	HITS-CLIP	19536157
MIRT724867	hsa-miR-4286	HITS-CLIP	19536157
MIRT724866	hsa-miR-371b-5p	HITS-CLIP	19536157
MIRT724865	hsa-miR-373-5p	HITS-CLIP	19536157
MIRT724864	hsa-miR-616-5p	HITS-CLIP	19536157
MIRT724863	hsa-miR-371a-5p	HITS-CLIP	19536157
MIRT724862	hsa-miR-372-5p	HITS-CLIP	19536157
MIRT724861	hsa-miR-513c-5p	HITS-CLIP	19536157
MIRT724860	hsa-miR-514b-5p	HITS-CLIP	19536157
MIRT724868	hsa-miR-330-3p	HITS-CLIP	19536157
MIRT724867	hsa-miR-4286	HITS-CLIP	19536157
MIRT724866	hsa-miR-371b-5p	HITS-CLIP	19536157
MIRT724865	hsa-miR-373-5p	HITS-CLIP	19536157
MIRT724864	hsa-miR-616-5p	HITS-CLIP	19536157
MIRT724863	hsa-miR-371a-5p	HITS-CLIP	19536157
MIRT724862	hsa-miR-372-5p	HITS-CLIP	19536157
MIRT724861	hsa-miR-513c-5p	HITS-CLIP	19536157
MIRT724860	hsa-miR-514b-5p	HITS-CLIP	19536157
MIRT1306737	hsa-miR-106a	CLIP-seq
MIRT1306738	hsa-miR-106b	CLIP-seq
MIRT1306739	hsa-miR-1224-5p	CLIP-seq
MIRT1306740	hsa-miR-1304	CLIP-seq
MIRT1306741	hsa-miR-1343	CLIP-seq
MIRT1306742	hsa-miR-17	CLIP-seq
MIRT1306743	hsa-miR-2053	CLIP-seq
MIRT1306744	hsa-miR-20a	CLIP-seq
MIRT1306745	hsa-miR-20b	CLIP-seq
MIRT1306746	hsa-miR-2110	CLIP-seq
MIRT1306747	hsa-miR-218	CLIP-seq
MIRT1306748	hsa-miR-219-5p	CLIP-seq
MIRT1306749	hsa-miR-2682	CLIP-seq
MIRT1306750	hsa-miR-3064-3p	CLIP-seq
MIRT1306751	hsa-miR-3140-3p	CLIP-seq
MIRT1306752	hsa-miR-3150b-3p	CLIP-seq
MIRT1306753	hsa-miR-3609	CLIP-seq
MIRT1306754	hsa-miR-3714	CLIP-seq
MIRT1306755	hsa-miR-374a	CLIP-seq
MIRT1306756	hsa-miR-374b	CLIP-seq
MIRT1306757	hsa-miR-3907	CLIP-seq
MIRT1306758	hsa-miR-3915	CLIP-seq
MIRT1306759	hsa-miR-4271	CLIP-seq
MIRT1306760	hsa-miR-4445	CLIP-seq
MIRT1306761	hsa-miR-4477a	CLIP-seq
MIRT1306762	hsa-miR-4484	CLIP-seq
MIRT1306763	hsa-miR-449c	CLIP-seq
MIRT1306764	hsa-miR-4689	CLIP-seq
MIRT1306765	hsa-miR-4709-3p	CLIP-seq
MIRT1306766	hsa-miR-4725-3p	CLIP-seq
MIRT1306767	hsa-miR-4766-5p	CLIP-seq
MIRT1306768	hsa-miR-4773	CLIP-seq
MIRT1306769	hsa-miR-4782-3p	CLIP-seq
MIRT1306770	hsa-miR-4784	CLIP-seq
MIRT1306771	hsa-miR-4796-3p	CLIP-seq
MIRT1306772	hsa-miR-508-3p	CLIP-seq
MIRT1306773	hsa-miR-519a	CLIP-seq
MIRT1306774	hsa-miR-519b-3p	CLIP-seq
MIRT1306775	hsa-miR-519c-3p	CLIP-seq
MIRT1306776	hsa-miR-519d	CLIP-seq
MIRT1306777	hsa-miR-520d-5p	CLIP-seq
MIRT1306778	hsa-miR-524-5p	CLIP-seq
MIRT1306779	hsa-miR-548ah	CLIP-seq
MIRT1306780	hsa-miR-548an	CLIP-seq
MIRT1306781	hsa-miR-622	CLIP-seq
MIRT1306782	hsa-miR-636	CLIP-seq
MIRT1306783	hsa-miR-765	CLIP-seq
MIRT1306784	hsa-miR-93	CLIP-seq
MIRT1306737	hsa-miR-106a	CLIP-seq
MIRT1306738	hsa-miR-106b	CLIP-seq
MIRT1306742	hsa-miR-17	CLIP-seq
MIRT1306744	hsa-miR-20a	CLIP-seq
MIRT1306745	hsa-miR-20b	CLIP-seq
MIRT2090915	hsa-miR-3176	CLIP-seq
MIRT2090916	hsa-miR-3922-3p	CLIP-seq
MIRT2090917	hsa-miR-4463	CLIP-seq
MIRT2090918	hsa-miR-4676-5p	CLIP-seq
MIRT2090919	hsa-miR-4701-5p	CLIP-seq
MIRT2090920	hsa-miR-4768-5p	CLIP-seq
MIRT2090921	hsa-miR-5095	CLIP-seq
MIRT1306773	hsa-miR-519a	CLIP-seq
MIRT1306774	hsa-miR-519b-3p	CLIP-seq
MIRT1306775	hsa-miR-519c-3p	CLIP-seq
MIRT1306776	hsa-miR-519d	CLIP-seq
MIRT2090922	hsa-miR-548u	CLIP-seq
MIRT2090923	hsa-miR-552	CLIP-seq
MIRT2090924	hsa-miR-575	CLIP-seq
MIRT2090925	hsa-miR-588	CLIP-seq
MIRT1306784	hsa-miR-93	CLIP-seq
MIRT2315559	hsa-miR-103a	CLIP-seq
MIRT2315560	hsa-miR-107	CLIP-seq
MIRT2315561	hsa-miR-1179	CLIP-seq
MIRT2315562	hsa-miR-148a	CLIP-seq
MIRT2315563	hsa-miR-148b	CLIP-seq
MIRT2315564	hsa-miR-152	CLIP-seq
MIRT2315565	hsa-miR-15a	CLIP-seq
MIRT2315566	hsa-miR-15b	CLIP-seq
MIRT2315567	hsa-miR-16	CLIP-seq
MIRT2315568	hsa-miR-195	CLIP-seq
MIRT1306743	hsa-miR-2053	CLIP-seq
MIRT2315569	hsa-miR-3064-5p	CLIP-seq
MIRT2315570	hsa-miR-3119	CLIP-seq
MIRT2315571	hsa-miR-34a	CLIP-seq
MIRT2315572	hsa-miR-34c-5p	CLIP-seq
MIRT2315573	hsa-miR-3652	CLIP-seq
MIRT2315574	hsa-miR-3653	CLIP-seq
MIRT2315575	hsa-miR-3658	CLIP-seq
MIRT2315576	hsa-miR-3944-5p	CLIP-seq
MIRT2315577	hsa-miR-424	CLIP-seq
MIRT2315578	hsa-miR-4293	CLIP-seq
MIRT2315579	hsa-miR-4310	CLIP-seq
MIRT2315580	hsa-miR-4430	CLIP-seq
MIRT2315581	hsa-miR-4453	CLIP-seq
MIRT2090917	hsa-miR-4463	CLIP-seq
MIRT2315582	hsa-miR-449a	CLIP-seq
MIRT2315583	hsa-miR-449b	CLIP-seq
MIRT2315584	hsa-miR-4505	CLIP-seq
MIRT2315585	hsa-miR-4538	CLIP-seq
MIRT2315586	hsa-miR-488	CLIP-seq
MIRT2315587	hsa-miR-497	CLIP-seq
MIRT2090921	hsa-miR-5095	CLIP-seq
MIRT2090922	hsa-miR-548u	CLIP-seq
MIRT2090923	hsa-miR-552	CLIP-seq
MIRT2315588	hsa-miR-596	CLIP-seq
MIRT2090915	hsa-miR-3176	CLIP-seq
MIRT2090916	hsa-miR-3922-3p	CLIP-seq
MIRT2442561	hsa-miR-214	CLIP-seq
MIRT2442562	hsa-miR-3619-5p	CLIP-seq
MIRT2442563	hsa-miR-4291	CLIP-seq
MIRT2442564	hsa-miR-578	CLIP-seq
MIRT2442565	hsa-miR-761	CLIP-seq
MIRT2442566	hsa-miR-922	CLIP-seq
MIRT2458236	hsa-miR-3978	CLIP-seq

Show/Hide all (5)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IEA
GO:0007274	Process	Neuromuscular synaptic transmission	IBA
GO:0016020	Component	Membrane	IEA
GO:0045202	Component	Synapse	IEA

MIM	HGNC	e!Ensembl
611602	30339	ENSG00000060709

O15034

Protein name

RIMS-binding protein 2 (RIM-BP2)

Protein function

Plays a role in the synaptic transmission as bifunctional linker that interacts simultaneously with RIMS1, RIMS2, CACNA1D and CACNA1B.

PDB

1WIE , 2CSI , 2CSP , 2CSQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14604	SH3_9	174 → 230	Variant SH3 domain	Domain
PF07653	SH3_2	852 → 914	Variant SH3 domain	Domain
PF14604	SH3_9	959 → 1015	Variant SH3 domain	Domain

Sequence

MREAAERRQQLQLEHDQALAVLSAKQQEIDLLQKSKVRELEEKCRTQSEQFNLLSRDLEK
FRQHAGKIDLLGGSAVAPLDISTAPSKPFPQFMNGLATSLGKGQESAIGGSSAIGEYIRP
LPQPGDRPEPLSAKPTFLSRSGSARCRSESDMENERNSNTSKQRYSGKVHLCVARYSYNP
FDGPNENPEAELPLTAGKYLYVYGDMDEDGFYEGELLDGQRGLVPSNFVDFVQDNESRLA
STLGNEQDQNFINHSGIGLEGEHILDLHSPTHIDAGITDNSAGTLDVNIDDIGEDIVPYP
RKITLIKQLAKSVIVGWEPPAVPPGWGTVSSYNVLVDKETRMNLTLGSRTKALIEKLNMA
ACTYRISVQCVTSRGSSDELQCTLLVGKDVVVAPSHLRVDNITQISAQLSWLPTNSNYSH
VIFLNEEEFDIVKAARYKYQFFNLRPNMAYKVKVLAKPHQMPWQLPLEQREKKEAFVEFS
TLPAGPPAPPQDVTVQAGVTPATIRVSWRPPVLTPTGLSNGANVTGYGVYAKGQRVAEVI
FPTADSTAVELVRLRSLEAKGVTVRTLSAQGESVDSAVAAVPPELLVPPTPHPRPAPQSK
PLASSGVPETKDEHLGPHARMDEAWEQSRAPGPVHGHMLEPPVGPGRRSPSPSRILPQPQ
GTPVSTTVAKAMAREAAQRVAESSRLEKRSVFLERSSAGQYAASDEEDAYDSPDFKRRGA
SVDDFLKGSELGKQPHCCHGDEYHTESSRGSDLSDIMEEDEEELYSEMQLEDGGRRRPSG
TSHNALKILGNPASAGRVDHMGRRFPRGSAGPQRSRPVTVPSIDDYGRDRLSPDFYEESE
TDPGAEELPARIFVALFDYDPLTMSPNPDAAEEELPFKEGQIIKVYGDKDADGFYRGETC
ARLGLIPCNMVSEIQADDEEMMDQLLRQGFLPLNTPVEKIERSRRSGRRHSVSTRRMVAL
YDYDPRESSPNVDVEAELTFCTGDIITVFGEIDEDGFYYGELNGQKGLVPSNFLEEVPDD
VEVYLSDAPSHYSQDTPMRSKAKRKKSVHFTP

Sequence length

1052

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (60)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	27008505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	22153617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	37466093	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	25797252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	25575817, 31374292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12907615, 24582965, 29028222		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	BEFREE	12907615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34147074, 35473892	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	32036209	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	22153617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne syndrome	Pubtator	7957102	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	20063376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16215318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	8844119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	8844119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	8844119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	26264242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	26264242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	GWASDB_DG	19196962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	12907615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	24763552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	7666002	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	20644511, 25575817	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	24454846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	12844477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23922798, 28582381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24376841	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	20644511	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24582965, 29028222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	26264242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19850045, 24716659, 25015565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27224921, 29028222, 29610306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	22153617		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	9293476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	25575817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12907615, 20973793, 21054651, 24068396, 24582965, 25015565, 25797252, 31727771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	18955045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24376841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	29028222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	8179592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	24068396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	37466093	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	21262986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	16215318, 8931868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16215318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	10446990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	16215318, 8931868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	26945879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	26945879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	31727771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	26945879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	9568080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19850045, 24716659, 25015565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27224921	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	24068396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	24068396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	24068396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	24068396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	16004614	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RIMBP2 (RIMS binding protein 2)