Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	23492
Gene name	Chromobox 7
Gene symbol	CBX7
Synonyms (NCBI Gene)	-
Chromosome	22
Chromosome location	22q13.1
Summary	This gene encodes a protein that contains the CHROMO (CHRomatin Organization MOdifier) domain. The encoded protein is a component of the Polycomb repressive complex 1 (PRC1), and is thought to control the lifespan of several normal human cells. [provided

228

Show/Hide all (228)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001104	hsa-miR-421	qRT-PCRWestern blot	19802518
MIRT006371	hsa-miR-181b-5p	Luciferase reporter assay	21779448
MIRT006371	hsa-miR-181b-5p	Luciferase reporter assay	21779448
MIRT006371	hsa-miR-181b-5p	Luciferase reporter assay	21779448
MIRT006371	hsa-miR-181b-5p	Luciferase reporter assay	21779448
MIRT006371	hsa-miR-181b-5p	Luciferase reporter assay	21779448
MIRT006371	hsa-miR-181b-5p	Luciferase reporter assay	21779448
MIRT039038	hsa-miR-766-3p	CLASH	23622248
MIRT532660	hsa-miR-548aa	PAR-CLIP	22012620
MIRT532659	hsa-miR-548ap-3p	PAR-CLIP	22012620
MIRT532658	hsa-miR-548t-3p	PAR-CLIP	22012620
MIRT532657	hsa-miR-548as-3p	PAR-CLIP	22012620
MIRT532656	hsa-miR-548at-3p	PAR-CLIP	22012620
MIRT532655	hsa-miR-548ay-3p	PAR-CLIP	22012620
MIRT485708	hsa-miR-4700-3p	PAR-CLIP	23592263
MIRT485707	hsa-miR-3169	PAR-CLIP	23592263
MIRT485704	hsa-miR-4515	PAR-CLIP	23592263
MIRT485703	hsa-miR-6818-3p	PAR-CLIP	23592263
MIRT485708	hsa-miR-4700-3p	PAR-CLIP	23592263
MIRT485707	hsa-miR-3169	PAR-CLIP	23592263
MIRT485706	hsa-miR-7-5p	PAR-CLIP	23592263
MIRT485705	hsa-miR-6077	PAR-CLIP	23592263
MIRT485704	hsa-miR-4515	PAR-CLIP	23592263
MIRT485703	hsa-miR-6818-3p	PAR-CLIP	23592263
MIRT728042	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT728040	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT731983	hsa-miR-18a-3p	Luciferase reporter assayWestern blot	28123848
MIRT731983	hsa-miR-18a-3p	Luciferase reporter assayWestern blot	28123848
MIRT532660	hsa-miR-548aa	PAR-CLIP	22012620
MIRT532659	hsa-miR-548ap-3p	PAR-CLIP	22012620
MIRT532658	hsa-miR-548t-3p	PAR-CLIP	22012620
MIRT532657	hsa-miR-548as-3p	PAR-CLIP	22012620
MIRT532656	hsa-miR-548at-3p	PAR-CLIP	22012620
MIRT532655	hsa-miR-548ay-3p	PAR-CLIP	22012620
MIRT485708	hsa-miR-4700-3p	PAR-CLIP	23592263
MIRT485707	hsa-miR-3169	PAR-CLIP	23592263
MIRT485704	hsa-miR-4515	PAR-CLIP	23592263
MIRT485703	hsa-miR-6818-3p	PAR-CLIP	23592263
MIRT485708	hsa-miR-4700-3p	PAR-CLIP	23592263
MIRT485707	hsa-miR-3169	PAR-CLIP	23592263
MIRT485706	hsa-miR-7-5p	PAR-CLIP	23592263
MIRT485705	hsa-miR-6077	PAR-CLIP	23592263
MIRT485704	hsa-miR-4515	PAR-CLIP	23592263
MIRT485703	hsa-miR-6818-3p	PAR-CLIP	23592263
MIRT866903	hsa-miR-1197	CLIP-seq
MIRT866904	hsa-miR-1207-5p	CLIP-seq
MIRT866905	hsa-miR-150	CLIP-seq
MIRT866906	hsa-miR-224	CLIP-seq
MIRT866907	hsa-miR-2861	CLIP-seq
MIRT866908	hsa-miR-296-5p	CLIP-seq
MIRT866909	hsa-miR-342-5p	CLIP-seq
MIRT866910	hsa-miR-345	CLIP-seq
MIRT866911	hsa-miR-361-3p	CLIP-seq
MIRT866912	hsa-miR-4268	CLIP-seq
MIRT866913	hsa-miR-4297	CLIP-seq
MIRT866914	hsa-miR-4419a	CLIP-seq
MIRT866915	hsa-miR-4434	CLIP-seq
MIRT866916	hsa-miR-4436a	CLIP-seq
MIRT866917	hsa-miR-4448	CLIP-seq
MIRT866918	hsa-miR-4505	CLIP-seq
MIRT866919	hsa-miR-4510	CLIP-seq
MIRT866920	hsa-miR-4516	CLIP-seq
MIRT866921	hsa-miR-4522	CLIP-seq
MIRT866922	hsa-miR-4651	CLIP-seq
MIRT866923	hsa-miR-4664-5p	CLIP-seq
MIRT866924	hsa-miR-4701-5p	CLIP-seq
MIRT866925	hsa-miR-4713-5p	CLIP-seq
MIRT866926	hsa-miR-4714-5p	CLIP-seq
MIRT866927	hsa-miR-4731-5p	CLIP-seq
MIRT866928	hsa-miR-4736	CLIP-seq
MIRT866929	hsa-miR-4763-3p	CLIP-seq
MIRT866930	hsa-miR-4764-3p	CLIP-seq
MIRT866931	hsa-miR-4786-3p	CLIP-seq
MIRT866932	hsa-miR-483-3p	CLIP-seq
MIRT866933	hsa-miR-532-3p	CLIP-seq
MIRT866934	hsa-miR-570	CLIP-seq
MIRT866935	hsa-miR-588	CLIP-seq
MIRT866936	hsa-miR-608	CLIP-seq
MIRT866937	hsa-miR-668	CLIP-seq
MIRT866938	hsa-miR-671-5p	CLIP-seq
MIRT866908	hsa-miR-296-5p	CLIP-seq
MIRT1546224	hsa-miR-3127-3p	CLIP-seq
MIRT1546225	hsa-miR-3189-3p	CLIP-seq
MIRT1546226	hsa-miR-635	CLIP-seq
MIRT866904	hsa-miR-1207-5p	CLIP-seq
MIRT1957242	hsa-miR-1227	CLIP-seq
MIRT1957243	hsa-miR-125a-5p	CLIP-seq
MIRT1957244	hsa-miR-125b	CLIP-seq
MIRT1957245	hsa-miR-1285	CLIP-seq
MIRT1957246	hsa-miR-146b-3p	CLIP-seq
MIRT1957247	hsa-miR-1587	CLIP-seq
MIRT866908	hsa-miR-296-5p	CLIP-seq
MIRT1546224	hsa-miR-3127-3p	CLIP-seq
MIRT1957248	hsa-miR-3173-3p	CLIP-seq
MIRT1957249	hsa-miR-3173-5p	CLIP-seq
MIRT1957250	hsa-miR-3177-3p	CLIP-seq
MIRT1957251	hsa-miR-3187-5p	CLIP-seq
MIRT1546225	hsa-miR-3189-3p	CLIP-seq
MIRT1957252	hsa-miR-3202	CLIP-seq
MIRT1957253	hsa-miR-326	CLIP-seq
MIRT1957254	hsa-miR-330-5p	CLIP-seq
MIRT866911	hsa-miR-361-3p	CLIP-seq
MIRT1957255	hsa-miR-3650	CLIP-seq
MIRT1957256	hsa-miR-3652	CLIP-seq
MIRT1957257	hsa-miR-378g	CLIP-seq
MIRT1957258	hsa-miR-3934	CLIP-seq
MIRT1957259	hsa-miR-3937	CLIP-seq
MIRT1957260	hsa-miR-4319	CLIP-seq
MIRT1957261	hsa-miR-4324	CLIP-seq
MIRT1957262	hsa-miR-4430	CLIP-seq
MIRT1957263	hsa-miR-4446-3p	CLIP-seq
MIRT1957264	hsa-miR-4486	CLIP-seq
MIRT1957265	hsa-miR-4487	CLIP-seq
MIRT1957266	hsa-miR-4492	CLIP-seq
MIRT1957267	hsa-miR-4498	CLIP-seq
MIRT1957268	hsa-miR-4533	CLIP-seq
MIRT1957269	hsa-miR-4641	CLIP-seq
MIRT1957270	hsa-miR-4645-5p	CLIP-seq
MIRT1957271	hsa-miR-4656	CLIP-seq
MIRT1957272	hsa-miR-4673	CLIP-seq
MIRT1957273	hsa-miR-4675	CLIP-seq
MIRT1957274	hsa-miR-4695-5p	CLIP-seq
MIRT1957275	hsa-miR-4729	CLIP-seq
MIRT866928	hsa-miR-4736	CLIP-seq
MIRT1957276	hsa-miR-4741	CLIP-seq
MIRT1957277	hsa-miR-4755-3p	CLIP-seq
MIRT866929	hsa-miR-4763-3p	CLIP-seq
MIRT1957278	hsa-miR-4763-5p	CLIP-seq
MIRT866931	hsa-miR-4786-3p	CLIP-seq
MIRT1957279	hsa-miR-558	CLIP-seq
MIRT1957280	hsa-miR-612	CLIP-seq
MIRT1957281	hsa-miR-617	CLIP-seq
MIRT1546226	hsa-miR-635	CLIP-seq
MIRT866938	hsa-miR-671-5p	CLIP-seq
MIRT1957282	hsa-miR-762	CLIP-seq
MIRT1957283	hsa-miR-874	CLIP-seq
MIRT2194208	hsa-miR-1193	CLIP-seq
MIRT2194209	hsa-miR-1202	CLIP-seq
MIRT1957242	hsa-miR-1227	CLIP-seq
MIRT1957245	hsa-miR-1285	CLIP-seq
MIRT2194210	hsa-miR-1293	CLIP-seq
MIRT1957247	hsa-miR-1587	CLIP-seq
MIRT2194211	hsa-miR-218	CLIP-seq
MIRT2194212	hsa-miR-219-2-3p	CLIP-seq
MIRT2194213	hsa-miR-2277-3p	CLIP-seq
MIRT2194214	hsa-miR-2964a-3p	CLIP-seq
MIRT2194215	hsa-miR-298	CLIP-seq
MIRT2194216	hsa-miR-3125	CLIP-seq
MIRT1546224	hsa-miR-3127-3p	CLIP-seq
MIRT2194217	hsa-miR-3135b	CLIP-seq
MIRT2194218	hsa-miR-3150b-3p	CLIP-seq
MIRT1957251	hsa-miR-3187-5p	CLIP-seq
MIRT2194219	hsa-miR-3192	CLIP-seq
MIRT2194220	hsa-miR-3200-3p	CLIP-seq
MIRT866910	hsa-miR-345	CLIP-seq
MIRT866911	hsa-miR-361-3p	CLIP-seq
MIRT2194221	hsa-miR-3616-3p	CLIP-seq
MIRT2194222	hsa-miR-3658	CLIP-seq
MIRT2194223	hsa-miR-3660	CLIP-seq
MIRT2194224	hsa-miR-3663-3p	CLIP-seq
MIRT2194225	hsa-miR-3689d	CLIP-seq
MIRT2194226	hsa-miR-3916	CLIP-seq
MIRT1957259	hsa-miR-3937	CLIP-seq
MIRT2194227	hsa-miR-3972	CLIP-seq
MIRT2194228	hsa-miR-4254	CLIP-seq
MIRT2194229	hsa-miR-4314	CLIP-seq
MIRT2194230	hsa-miR-4417	CLIP-seq
MIRT2194231	hsa-miR-4436b-3p	CLIP-seq
MIRT2194232	hsa-miR-4447	CLIP-seq
MIRT2194233	hsa-miR-4472	CLIP-seq
MIRT2194234	hsa-miR-4483	CLIP-seq
MIRT1957266	hsa-miR-4492	CLIP-seq
MIRT1957267	hsa-miR-4498	CLIP-seq
MIRT866918	hsa-miR-4505	CLIP-seq
MIRT866921	hsa-miR-4522	CLIP-seq
MIRT2194235	hsa-miR-4526	CLIP-seq
MIRT1957270	hsa-miR-4645-5p	CLIP-seq
MIRT2194236	hsa-miR-4646-5p	CLIP-seq
MIRT866922	hsa-miR-4651	CLIP-seq
MIRT1957271	hsa-miR-4656	CLIP-seq
MIRT1957272	hsa-miR-4673	CLIP-seq
MIRT1957273	hsa-miR-4675	CLIP-seq
MIRT2194237	hsa-miR-4680-3p	CLIP-seq
MIRT2194238	hsa-miR-4709-5p	CLIP-seq
MIRT866926	hsa-miR-4714-5p	CLIP-seq
MIRT2194239	hsa-miR-4722-3p	CLIP-seq
MIRT2194240	hsa-miR-4728-5p	CLIP-seq
MIRT1957275	hsa-miR-4729	CLIP-seq
MIRT866927	hsa-miR-4731-5p	CLIP-seq
MIRT1957276	hsa-miR-4741	CLIP-seq
MIRT2194241	hsa-miR-4747-5p	CLIP-seq
MIRT1957277	hsa-miR-4755-3p	CLIP-seq
MIRT866930	hsa-miR-4764-3p	CLIP-seq
MIRT2194242	hsa-miR-4784	CLIP-seq
MIRT2194243	hsa-miR-4799-5p	CLIP-seq
MIRT2194244	hsa-miR-486-3p	CLIP-seq
MIRT2194245	hsa-miR-505	CLIP-seq
MIRT2194246	hsa-miR-541	CLIP-seq
MIRT2194247	hsa-miR-548an	CLIP-seq
MIRT866936	hsa-miR-608	CLIP-seq
MIRT1957280	hsa-miR-612	CLIP-seq
MIRT2194248	hsa-miR-637	CLIP-seq
MIRT2194249	hsa-miR-654-5p	CLIP-seq
MIRT866938	hsa-miR-671-5p	CLIP-seq
MIRT1957282	hsa-miR-762	CLIP-seq
MIRT2194250	hsa-miR-877	CLIP-seq
MIRT1957242	hsa-miR-1227	CLIP-seq
MIRT1957258	hsa-miR-3934	CLIP-seq
MIRT2194232	hsa-miR-4447	CLIP-seq
MIRT2194233	hsa-miR-4472	CLIP-seq
MIRT866922	hsa-miR-4651	CLIP-seq
MIRT1957277	hsa-miR-4755-3p	CLIP-seq
MIRT2385594	hsa-miR-544	CLIP-seq
MIRT866936	hsa-miR-608	CLIP-seq
MIRT2194208	hsa-miR-1193	CLIP-seq
MIRT2194215	hsa-miR-298	CLIP-seq
MIRT2446270	hsa-miR-3150a-3p	CLIP-seq
MIRT2446271	hsa-miR-3175	CLIP-seq
MIRT2194240	hsa-miR-4728-5p	CLIP-seq
MIRT2446272	hsa-miR-939	CLIP-seq
MIRT2497656	hsa-miR-1207-3p	CLIP-seq
MIRT2497657	hsa-miR-3661	CLIP-seq
MIRT2497658	hsa-miR-4456	CLIP-seq
MIRT866924	hsa-miR-4701-5p	CLIP-seq
MIRT2497659	hsa-miR-4786-5p	CLIP-seq
MIRT866935	hsa-miR-588	CLIP-seq
MIRT2497660	hsa-miR-631	CLIP-seq
MIRT2497661	hsa-miR-769-5p	CLIP-seq

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	19636380, 21282530
GO:0000785	Component	Chromatin	IDA	19636380
GO:0005515	Function	Protein binding	IPI	10369680, 17332741, 18927235, 19636380, 20543829, 20601937, 20696397, 21282530, 23523425, 24981860, 27705803, 28514442, 32296183, 33961781
GO:0005634	Component	Nucleus	IDA	21282530
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006325	Process	Chromatin organization	IEA
GO:0031519	Component	PcG protein complex	IBA
GO:0031519	Component	PcG protein complex	IDA	21282530
GO:0031519	Component	PcG protein complex	IEA
GO:0035102	Component	PRC1 complex	IEA
GO:0035102	Component	PRC1 complex	ISS

MIM	HGNC	e!Ensembl
608457	1557	ENSG00000100307

O95931

Protein name

Chromobox protein homolog 7

Protein function

Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remod

PDB

2K1B , 2L12 , 2L1B , 3GS2 , 4MN3 , 5EPJ , 6V2R , 8SII

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00385	Chromo	11 → 60	Chromo (CHRromatin Organisation MOdifier) domain	Domain
PF17218	CBX7_C	209 → 240	CBX family C-terminal motif	Motif

Sequence

MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEK
EERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKA
GAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAP
DVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAA
EGFFRDRSGKF

Sequence length

251

Interactions

View interactions

	KEGG
	Polycomb repressive complex

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MULTIPLE MYELOMA	—	CTD, GWAS catalog CTD, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (84)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	20185297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	20185297, 28030829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	19706751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	19706751		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28030829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	24260522	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	17374722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	34008756	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25351982, 29190923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27102007, 33400401	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33082469	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	18984978, 22214847, 22544325, 24865347, 25595895, 25881303, 26216446, 28259135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	19602592	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30481161, 31211140	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31211140	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	21375733	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24865347, 26216446, 30584339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36183965	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	25596753	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31709304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	31709304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	20542683, 28259135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	36183965	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20542683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32953885	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	36221371	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	30249557	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	30249557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23680149, 27291091, 28123848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24260522, 35210369	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	27291091	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23680149, 27291091, 28123848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	27291091, 28388562, 28460453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27291091	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	23955597	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	20185297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	17374722, 20723236		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	30759399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	39613290	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	36081495	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30759399, 30940663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29386090, 30481161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	20723236	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	20723236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	20723236	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	17374722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	28460453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25351982, 29190923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26216446, 30584339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	20185297, 28030829, 28388562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20541999, 27449098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	20723236, 29422082, 30249557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	18701502, 20542683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15897876, 17374722, 18701502, 19602592, 20185297, 20723236, 22214847, 22544325, 25351982, 25595895, 25881303, 28030829, 30826432, 31630421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	31709304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	20542683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	25351982, 27102007, 29190923		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15897876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	32860274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	GWASCAT_DG	23502783, 23955597, 27363682		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	CTD_human_DG	23955597		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	GWASDB_DG	23955597		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	Pubtator	23955597, 24449210	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	BEFREE	27587788, 29262596		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	17374722, 18701502, 18984978, 19706751, 20723236, 22214847, 22544325, 23680149, 25351982, 25595895, 25881303, 27449098, 28030829, 28259135, 28388562 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30584339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	21375733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32205869, 32495862	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	20185297, 28030829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	28030829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary amyloidosis	Amyloidosis	GWASCAT_DG	28025584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20541999, 27449098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33245100	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	20723236, 29422082, 30249557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20723236, 21060834, 29422082, 34117289, 35969177	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30249557	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	25596753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	18701502, 19706751, 20542683, 24865347, 28259135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	18701502, 20542683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	18701502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	25596753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	18984978	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25596753	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	18984978		★★★★★ ★☆☆☆☆ Found in Text Mining only

CBX7 (chromobox 7)