Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	23478
Gene name	SEC11 homolog A, signal peptidase complex subunit
Gene symbol	SEC11A
Synonyms (NCBI Gene)	1810012E07RikSEC11L1SPC18SPCS4Asid2895
Chromosome	15
Chromosome location	15q25.2-q25.3
Summary	This gene encodes a member of the peptidase S26B family. The encoded protein is an 18kDa subunit of the signal peptidase complex and has been linked to cell migration and invasion, gastric cancer and lymph node metastasis. Alternative splicing results in

163

Show/Hide all (163)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004120	hsa-miR-124-3p	Microarray	15685193
MIRT004120	hsa-miR-124-3p	Microarray	18668037
MIRT004120	hsa-miR-124-3p	Microarray	15685193
MIRT028396	hsa-miR-30a-5p	Proteomics	18668040
MIRT031376	hsa-miR-16-5p	Proteomics	18668040
MIRT032228	hsa-let-7b-5p	Proteomics	18668040
MIRT041796	hsa-miR-484	CLASH	23622248
MIRT1332110	hsa-miR-1264	CLIP-seq
MIRT1332111	hsa-miR-134	CLIP-seq
MIRT1332112	hsa-miR-136	CLIP-seq
MIRT1332113	hsa-miR-141	CLIP-seq
MIRT1332114	hsa-miR-1825	CLIP-seq
MIRT1332115	hsa-miR-1912	CLIP-seq
MIRT1332116	hsa-miR-1914	CLIP-seq
MIRT1332117	hsa-miR-19a	CLIP-seq
MIRT1332118	hsa-miR-19b	CLIP-seq
MIRT1332119	hsa-miR-200a	CLIP-seq
MIRT1332120	hsa-miR-208a	CLIP-seq
MIRT1332121	hsa-miR-208b	CLIP-seq
MIRT1332122	hsa-miR-2117	CLIP-seq
MIRT1332123	hsa-miR-24	CLIP-seq
MIRT1332124	hsa-miR-29a	CLIP-seq
MIRT1332125	hsa-miR-29b	CLIP-seq
MIRT1332126	hsa-miR-29c	CLIP-seq
MIRT1332127	hsa-miR-3118	CLIP-seq
MIRT1332128	hsa-miR-3128	CLIP-seq
MIRT1332129	hsa-miR-3129-3p	CLIP-seq
MIRT1332130	hsa-miR-3130-5p	CLIP-seq
MIRT1332131	hsa-miR-3136-5p	CLIP-seq
MIRT1332132	hsa-miR-3163	CLIP-seq
MIRT1332133	hsa-miR-3164	CLIP-seq
MIRT1332134	hsa-miR-3171	CLIP-seq
MIRT1332135	hsa-miR-3622b-5p	CLIP-seq
MIRT1332136	hsa-miR-3664-5p	CLIP-seq
MIRT1332137	hsa-miR-3688-3p	CLIP-seq
MIRT1332138	hsa-miR-4261	CLIP-seq
MIRT1332139	hsa-miR-4273	CLIP-seq
MIRT1332140	hsa-miR-4282	CLIP-seq
MIRT1332141	hsa-miR-4284	CLIP-seq
MIRT1332142	hsa-miR-4420	CLIP-seq
MIRT1332143	hsa-miR-4432	CLIP-seq
MIRT1332144	hsa-miR-4439	CLIP-seq
MIRT1332145	hsa-miR-4453	CLIP-seq
MIRT1332146	hsa-miR-4482	CLIP-seq
MIRT1332147	hsa-miR-4488	CLIP-seq
MIRT1332148	hsa-miR-4504	CLIP-seq
MIRT1332149	hsa-miR-4513	CLIP-seq
MIRT1332150	hsa-miR-4538	CLIP-seq
MIRT1332151	hsa-miR-4670-3p	CLIP-seq
MIRT1332152	hsa-miR-4697-5p	CLIP-seq
MIRT1332153	hsa-miR-4698	CLIP-seq
MIRT1332154	hsa-miR-4705	CLIP-seq
MIRT1332155	hsa-miR-4707-3p	CLIP-seq
MIRT1332156	hsa-miR-4714-3p	CLIP-seq
MIRT1332157	hsa-miR-4720-5p	CLIP-seq
MIRT1332158	hsa-miR-4766-5p	CLIP-seq
MIRT1332159	hsa-miR-4787-3p	CLIP-seq
MIRT1332160	hsa-miR-4797-3p	CLIP-seq
MIRT1332161	hsa-miR-4799-3p	CLIP-seq
MIRT1332162	hsa-miR-4803	CLIP-seq
MIRT1332163	hsa-miR-488	CLIP-seq
MIRT1332164	hsa-miR-494	CLIP-seq
MIRT1332165	hsa-miR-499-5p	CLIP-seq
MIRT1332166	hsa-miR-515-5p	CLIP-seq
MIRT1332167	hsa-miR-518a-5p	CLIP-seq
MIRT1332168	hsa-miR-527	CLIP-seq
MIRT1332169	hsa-miR-542-3p	CLIP-seq
MIRT1332170	hsa-miR-590-3p	CLIP-seq
MIRT1332171	hsa-miR-595	CLIP-seq
MIRT1332172	hsa-miR-637	CLIP-seq
MIRT1332173	hsa-miR-889	CLIP-seq
MIRT2098168	hsa-miR-183	CLIP-seq
MIRT2098169	hsa-miR-202	CLIP-seq
MIRT1332120	hsa-miR-208a	CLIP-seq
MIRT1332121	hsa-miR-208b	CLIP-seq
MIRT2098170	hsa-miR-3154	CLIP-seq
MIRT2098171	hsa-miR-3173-3p	CLIP-seq
MIRT1332140	hsa-miR-4282	CLIP-seq
MIRT1332143	hsa-miR-4432	CLIP-seq
MIRT2098172	hsa-miR-4642	CLIP-seq
MIRT2098173	hsa-miR-4757-3p	CLIP-seq
MIRT1332160	hsa-miR-4797-3p	CLIP-seq
MIRT1332165	hsa-miR-499-5p	CLIP-seq
MIRT2098174	hsa-miR-607	CLIP-seq
MIRT2322908	hsa-miR-127-5p	CLIP-seq
MIRT1332114	hsa-miR-1825	CLIP-seq
MIRT2098168	hsa-miR-183	CLIP-seq
MIRT1332115	hsa-miR-1912	CLIP-seq
MIRT2322909	hsa-miR-1915	CLIP-seq
MIRT1332124	hsa-miR-29a	CLIP-seq
MIRT1332125	hsa-miR-29b	CLIP-seq
MIRT1332126	hsa-miR-29c	CLIP-seq
MIRT2322910	hsa-miR-3120-3p	CLIP-seq
MIRT1332129	hsa-miR-3129-3p	CLIP-seq
MIRT1332130	hsa-miR-3130-5p	CLIP-seq
MIRT2322911	hsa-miR-3137	CLIP-seq
MIRT2322912	hsa-miR-3145-5p	CLIP-seq
MIRT2322913	hsa-miR-3622a-5p	CLIP-seq
MIRT2322914	hsa-miR-3714	CLIP-seq
MIRT2322915	hsa-miR-4423-3p	CLIP-seq
MIRT1332146	hsa-miR-4482	CLIP-seq
MIRT2098172	hsa-miR-4642	CLIP-seq
MIRT1332154	hsa-miR-4705	CLIP-seq
MIRT2322916	hsa-miR-4708-3p	CLIP-seq
MIRT2322917	hsa-miR-4712-5p	CLIP-seq
MIRT2322918	hsa-miR-4726-3p	CLIP-seq
MIRT2322919	hsa-miR-508-5p	CLIP-seq
MIRT2322920	hsa-miR-593	CLIP-seq
MIRT2322921	hsa-miR-770-5p	CLIP-seq
MIRT2322922	hsa-miR-873	CLIP-seq
MIRT2322923	hsa-miR-940	CLIP-seq
MIRT1332114	hsa-miR-1825	CLIP-seq
MIRT1332115	hsa-miR-1912	CLIP-seq
MIRT1332130	hsa-miR-3130-5p	CLIP-seq
MIRT1332146	hsa-miR-4482	CLIP-seq
MIRT1332112	hsa-miR-136	CLIP-seq
MIRT1332114	hsa-miR-1825	CLIP-seq
MIRT1332115	hsa-miR-1912	CLIP-seq
MIRT1332122	hsa-miR-2117	CLIP-seq
MIRT1332124	hsa-miR-29a	CLIP-seq
MIRT1332125	hsa-miR-29b	CLIP-seq
MIRT1332126	hsa-miR-29c	CLIP-seq
MIRT1332128	hsa-miR-3128	CLIP-seq
MIRT1332129	hsa-miR-3129-3p	CLIP-seq
MIRT1332130	hsa-miR-3130-5p	CLIP-seq
MIRT1332135	hsa-miR-3622b-5p	CLIP-seq
MIRT1332136	hsa-miR-3664-5p	CLIP-seq
MIRT1332137	hsa-miR-3688-3p	CLIP-seq
MIRT1332138	hsa-miR-4261	CLIP-seq
MIRT1332139	hsa-miR-4273	CLIP-seq
MIRT1332146	hsa-miR-4482	CLIP-seq
MIRT1332154	hsa-miR-4705	CLIP-seq
MIRT1332155	hsa-miR-4707-3p	CLIP-seq
MIRT1332157	hsa-miR-4720-5p	CLIP-seq
MIRT1332159	hsa-miR-4787-3p	CLIP-seq
MIRT1332161	hsa-miR-4799-3p	CLIP-seq
MIRT1332162	hsa-miR-4803	CLIP-seq
MIRT1332164	hsa-miR-494	CLIP-seq
MIRT1332166	hsa-miR-515-5p	CLIP-seq
MIRT1332112	hsa-miR-136	CLIP-seq
MIRT1332114	hsa-miR-1825	CLIP-seq
MIRT1332115	hsa-miR-1912	CLIP-seq
MIRT1332122	hsa-miR-2117	CLIP-seq
MIRT1332124	hsa-miR-29a	CLIP-seq
MIRT1332125	hsa-miR-29b	CLIP-seq
MIRT1332126	hsa-miR-29c	CLIP-seq
MIRT1332128	hsa-miR-3128	CLIP-seq
MIRT1332129	hsa-miR-3129-3p	CLIP-seq
MIRT1332130	hsa-miR-3130-5p	CLIP-seq
MIRT1332135	hsa-miR-3622b-5p	CLIP-seq
MIRT1332136	hsa-miR-3664-5p	CLIP-seq
MIRT1332137	hsa-miR-3688-3p	CLIP-seq
MIRT1332138	hsa-miR-4261	CLIP-seq
MIRT1332139	hsa-miR-4273	CLIP-seq
MIRT1332146	hsa-miR-4482	CLIP-seq
MIRT1332154	hsa-miR-4705	CLIP-seq
MIRT1332155	hsa-miR-4707-3p	CLIP-seq
MIRT1332157	hsa-miR-4720-5p	CLIP-seq
MIRT1332159	hsa-miR-4787-3p	CLIP-seq
MIRT1332161	hsa-miR-4799-3p	CLIP-seq
MIRT1332162	hsa-miR-4803	CLIP-seq
MIRT1332164	hsa-miR-494	CLIP-seq
MIRT1332166	hsa-miR-515-5p	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	IDA	34388369
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0004252	Function	Serine-type endopeptidase activity	TAS
GO:0005515	Function	Protein binding	IPI	32296183, 33961781, 34388369
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005787	Component	Signal peptidase complex	IBA
GO:0005787	Component	Signal peptidase complex	IDA	34388369
GO:0005787	Component	Signal peptidase complex	IEA
GO:0005787	Component	Signal peptidase complex	IPI	34388369
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	34388369
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006465	Process	Signal peptide processing	IBA
GO:0006465	Process	Signal peptide processing	IDA	34388369
GO:0006465	Process	Signal peptide processing	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IBA
GO:0008233	Function	Peptidase activity	IEA
GO:0009615	Process	Response to virus	TAS
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA

MIM	HGNC	e!Ensembl
618258	17718	ENSG00000140612

P67812

Protein name

Signal peptidase complex catalytic subunit SEC11A (EC 3.4.21.89) (Endopeptidase SP18) (Microsomal signal peptidase 18 kDa subunit) (SPase 18 kDa subunit) (SEC11 homolog A) (SEC11-like protein 1) (SPC18)

Protein function

Catalytic component of the signal peptidase complex (SPC) which catalyzes the cleavage of N-terminal signal sequences from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum (PubMed:34388369). Specifically clea

PDB

7P2P

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00717	Peptidase_S24	22 → 143	Peptidase S24-like	Domain

Sequence

MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPA
FHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQNGHIKFLTKGDNNAV
DDRGLYKQGQHWLEKKDVVGRARGFVPYIGIVTILMNDYPKFKYAVLFLLGLFVLVHRE

Sequence length

179

Interactions

View interactions

	KEGG		Reactome
	Protein export		Synthesis, secretion, and deacylation of Ghrelin

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENINGIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (16)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenoma	Adenoma	BEFREE	27859949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	GWASCAT_DG	30552317		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	31163419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	27859949	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	31163419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Polyps	Colonic polyps	Pubtator	27859949	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27859949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27859949	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	30552317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23995782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	31163419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19261089, 27859949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35653344	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23995782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32054332	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	GWASCAT_DG	30552317		★★★★★ ★☆☆☆☆ Found in Text Mining only

SEC11A (SEC11 homolog A, signal peptidase complex subunit)