BRD4 (bromodomain containing 4)

Gene

• Entrez ID: 23476
• Gene name: Bromodomain containing 4
• Gene symbol: BRD4
• Synonyms (NCBI Gene): CAP, CDLS6, FSHRG4, HUNK1, HUNKI, MCAP
• Chromosome: 19
• Chromosome location: 19p13.12
• Summary: The protein encoded by this gene is homologous to the murine protein MCAP, which associates with chromosomes during mitosis, and to the human RING3 protein, a serine/threonine kinase. Each of these proteins contains two bromodomains, a conserved sequence

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1555737887	T>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1568383758	C>A	Likely-pathogenic	Coding sequence variant, missense variant
rs1599473950	GTG>-	Likely-pathogenic	Coding sequence variant, inframe deletion

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029120	hsa-miR-26b-5p	Microarray	19088304
MIRT044471	hsa-miR-320a	CLASH	23622248
MIRT042219	hsa-miR-484	CLASH	23622248
MIRT037828	hsa-miR-455-3p	CLASH	23622248
MIRT036894	hsa-miR-877-3p	CLASH	23622248
MIRT035757	hsa-miR-2110	CLASH	23622248
MIRT615098	hsa-miR-548ac	HITS-CLIP	23824327
MIRT615097	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT615096	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT615095	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT615094	hsa-miR-548z	HITS-CLIP	23824327
MIRT615093	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT660149	hsa-miR-1306-5p	HITS-CLIP	23824327
MIRT660148	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT660147	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT660146	hsa-miR-8485	HITS-CLIP	23824327
MIRT660145	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT613277	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT613276	hsa-miR-6731-3p	HITS-CLIP	23824327
MIRT613272	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT613271	hsa-miR-507	HITS-CLIP	23824327
MIRT613270	hsa-miR-557	HITS-CLIP	23824327
MIRT613269	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT615098	hsa-miR-548ac	HITS-CLIP	23824327
MIRT615097	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT615096	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT615095	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT615094	hsa-miR-548z	HITS-CLIP	23824327
MIRT615093	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT615098	hsa-miR-548ac	HITS-CLIP	23824327
MIRT615097	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT615096	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT615095	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT615094	hsa-miR-548z	HITS-CLIP	23824327
MIRT636685	hsa-miR-4495	HITS-CLIP	23824327
MIRT636684	hsa-miR-379-3p	HITS-CLIP	23824327
MIRT636683	hsa-miR-411-3p	HITS-CLIP	23824327
MIRT636682	hsa-miR-380-3p	HITS-CLIP	23824327
MIRT615093	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT615098	hsa-miR-548ac	HITS-CLIP	23824327
MIRT615097	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT615096	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT615095	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT615094	hsa-miR-548z	HITS-CLIP	23824327
MIRT636685	hsa-miR-4495	HITS-CLIP	23824327
MIRT636684	hsa-miR-379-3p	HITS-CLIP	23824327
MIRT636683	hsa-miR-411-3p	HITS-CLIP	23824327
MIRT636682	hsa-miR-380-3p	HITS-CLIP	23824327
MIRT615093	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT615098	hsa-miR-548ac	HITS-CLIP	23824327
MIRT615097	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT615096	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT615095	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT615094	hsa-miR-548z	HITS-CLIP	23824327
MIRT615093	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT613280	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT613279	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT613278	hsa-miR-3938	HITS-CLIP	23824327
MIRT613277	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT613276	hsa-miR-6731-3p	HITS-CLIP	23824327
MIRT613275	hsa-miR-623	HITS-CLIP	23824327
MIRT613274	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT613273	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT613272	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT613271	hsa-miR-507	HITS-CLIP	23824327
MIRT613270	hsa-miR-557	HITS-CLIP	23824327
MIRT613269	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT441106	hsa-miR-544a	HITS-CLIP	24374217
MIRT441106	hsa-miR-544a	HITS-CLIP	24374217
MIRT660148	hsa-miR-329-3p	Luciferase reporter assay, qRT-PCR, Western blot	26456956
MIRT660148	hsa-miR-329-3p	Luciferase reporter assay, qRT-PCR, Western blot	26456956
MIRT734104	hsa-miR-765	ELISA, Luciferase reporter assay, qRT-PCR, Western blotting	33686960
MIRT735339	hsa-miR-1293	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, qRT-PCR	32320642
MIRT615096	hsa-miR-548d-3p	Luciferase reporter assay, Immunoprecipitaion (IP), RNA-seq	31937753
MIRT736323	hsa-miR-608	Luciferase reporter assay, Western blotting, qRT-PCR	31621555
MIRT736323	hsa-miR-608	Western blotting, Microarray, qRT-PCR, Flow cytometry	32002032
MIRT736926	hsa-miR-381-3p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), qRT-PCR	34024119
MIRT615098	hsa-miR-548ac	HITS-CLIP	23824327
MIRT615097	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT615096	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT615095	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT615094	hsa-miR-548z	HITS-CLIP	23824327
MIRT615093	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT660149	hsa-miR-1306-5p	HITS-CLIP	23824327
MIRT660148	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT660147	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT660146	hsa-miR-8485	HITS-CLIP	23824327
MIRT660145	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT613277	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT613276	hsa-miR-6731-3p	HITS-CLIP	23824327
MIRT613272	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT613271	hsa-miR-507	HITS-CLIP	23824327
MIRT613270	hsa-miR-557	HITS-CLIP	23824327
MIRT613269	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT615098	hsa-miR-548ac	HITS-CLIP	23824327
MIRT615097	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT615096	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT615095	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT615094	hsa-miR-548z	HITS-CLIP	23824327
MIRT615093	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT615098	hsa-miR-548ac	HITS-CLIP	23824327
MIRT615097	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT615096	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT615095	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT615094	hsa-miR-548z	HITS-CLIP	23824327
MIRT636685	hsa-miR-4495	HITS-CLIP	23824327
MIRT636684	hsa-miR-379-3p	HITS-CLIP	23824327
MIRT636683	hsa-miR-411-3p	HITS-CLIP	23824327
MIRT636682	hsa-miR-380-3p	HITS-CLIP	23824327
MIRT615093	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT615098	hsa-miR-548ac	HITS-CLIP	23824327
MIRT615097	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT615096	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT615095	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT615094	hsa-miR-548z	HITS-CLIP	23824327
MIRT636685	hsa-miR-4495	HITS-CLIP	23824327
MIRT636684	hsa-miR-379-3p	HITS-CLIP	23824327
MIRT636683	hsa-miR-411-3p	HITS-CLIP	23824327
MIRT636682	hsa-miR-380-3p	HITS-CLIP	23824327
MIRT615093	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT615098	hsa-miR-548ac	HITS-CLIP	23824327
MIRT615097	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT615096	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT615095	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT615094	hsa-miR-548z	HITS-CLIP	23824327
MIRT615093	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT613280	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT613279	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT613278	hsa-miR-3938	HITS-CLIP	23824327
MIRT613277	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT613276	hsa-miR-6731-3p	HITS-CLIP	23824327
MIRT613275	hsa-miR-623	HITS-CLIP	23824327
MIRT613274	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT613273	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT613272	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT613271	hsa-miR-507	HITS-CLIP	23824327
MIRT613270	hsa-miR-557	HITS-CLIP	23824327
MIRT613269	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT824414	hsa-miR-1182	CLIP-seq
MIRT824415	hsa-miR-1208	CLIP-seq
MIRT824416	hsa-miR-1244	CLIP-seq
MIRT824417	hsa-miR-1255a	CLIP-seq
MIRT824418	hsa-miR-1255b	CLIP-seq
MIRT824419	hsa-miR-1273f	CLIP-seq
MIRT824420	hsa-miR-1287	CLIP-seq
MIRT824421	hsa-miR-1290	CLIP-seq
MIRT824422	hsa-miR-1302	CLIP-seq
MIRT824423	hsa-miR-143	CLIP-seq
MIRT824424	hsa-miR-149	CLIP-seq
MIRT824425	hsa-miR-1913	CLIP-seq
MIRT824426	hsa-miR-1915	CLIP-seq
MIRT824427	hsa-miR-2682	CLIP-seq
MIRT824428	hsa-miR-29a	CLIP-seq
MIRT824429	hsa-miR-29b	CLIP-seq
MIRT824430	hsa-miR-29c	CLIP-seq
MIRT824431	hsa-miR-3064-5p	CLIP-seq
MIRT824432	hsa-miR-3119	CLIP-seq
MIRT824433	hsa-miR-3135b	CLIP-seq
MIRT824434	hsa-miR-3158-3p	CLIP-seq
MIRT824435	hsa-miR-3167	CLIP-seq
MIRT824436	hsa-miR-3170	CLIP-seq
MIRT824437	hsa-miR-3189-5p	CLIP-seq
MIRT824438	hsa-miR-3199	CLIP-seq
MIRT824439	hsa-miR-324-3p	CLIP-seq
MIRT824440	hsa-miR-3591-3p	CLIP-seq
MIRT824441	hsa-miR-3675-5p	CLIP-seq
MIRT824442	hsa-miR-377	CLIP-seq
MIRT824443	hsa-miR-4257	CLIP-seq
MIRT824444	hsa-miR-4263	CLIP-seq
MIRT824445	hsa-miR-4269	CLIP-seq
MIRT824446	hsa-miR-4298	CLIP-seq
MIRT824447	hsa-miR-4311	CLIP-seq
MIRT824448	hsa-miR-4328	CLIP-seq
MIRT824449	hsa-miR-4433	CLIP-seq
MIRT824450	hsa-miR-4459	CLIP-seq
MIRT824451	hsa-miR-4477a	CLIP-seq
MIRT824452	hsa-miR-449c	CLIP-seq
MIRT824453	hsa-miR-4514	CLIP-seq
MIRT824454	hsa-miR-4521	CLIP-seq
MIRT824455	hsa-miR-4652-5p	CLIP-seq
MIRT824456	hsa-miR-4663	CLIP-seq
MIRT824457	hsa-miR-4668-5p	CLIP-seq
MIRT824458	hsa-miR-4675	CLIP-seq
MIRT824459	hsa-miR-4692	CLIP-seq
MIRT824460	hsa-miR-4701-5p	CLIP-seq
MIRT824461	hsa-miR-4708-5p	CLIP-seq
MIRT824462	hsa-miR-4740-5p	CLIP-seq
MIRT824463	hsa-miR-4741	CLIP-seq
MIRT824464	hsa-miR-4742-5p	CLIP-seq
MIRT824465	hsa-miR-4758-3p	CLIP-seq
MIRT824466	hsa-miR-4763-5p	CLIP-seq
MIRT824467	hsa-miR-4768-3p	CLIP-seq
MIRT824468	hsa-miR-4770	CLIP-seq
MIRT824469	hsa-miR-4779	CLIP-seq
MIRT824470	hsa-miR-4794	CLIP-seq
MIRT824471	hsa-miR-4797-5p	CLIP-seq
MIRT824472	hsa-miR-483-5p	CLIP-seq
MIRT824473	hsa-miR-486-3p	CLIP-seq
MIRT824474	hsa-miR-544	CLIP-seq
MIRT824475	hsa-miR-570	CLIP-seq
MIRT824476	hsa-miR-583	CLIP-seq
MIRT824477	hsa-miR-588	CLIP-seq
MIRT824478	hsa-miR-615-5p	CLIP-seq
MIRT824479	hsa-miR-663b	CLIP-seq
MIRT824480	hsa-miR-758	CLIP-seq
MIRT824481	hsa-miR-876-5p	CLIP-seq
MIRT824482	hsa-miR-890	CLIP-seq
MIRT824483	hsa-miR-1228	CLIP-seq
MIRT824484	hsa-miR-1231	CLIP-seq
MIRT824485	hsa-miR-1253	CLIP-seq
MIRT824486	hsa-miR-185	CLIP-seq
MIRT824487	hsa-miR-1914	CLIP-seq
MIRT824488	hsa-miR-2964a-5p	CLIP-seq
MIRT824489	hsa-miR-3123	CLIP-seq
MIRT824490	hsa-miR-3144-5p	CLIP-seq
MIRT824491	hsa-miR-3150a-3p	CLIP-seq
MIRT824492	hsa-miR-3150b-3p	CLIP-seq
MIRT824493	hsa-miR-3154	CLIP-seq
MIRT824494	hsa-miR-3191	CLIP-seq
MIRT824495	hsa-miR-4289	CLIP-seq
MIRT824496	hsa-miR-4306	CLIP-seq
MIRT824497	hsa-miR-4318	CLIP-seq
MIRT824498	hsa-miR-4434	CLIP-seq
MIRT824499	hsa-miR-4516	CLIP-seq
MIRT824500	hsa-miR-4519	CLIP-seq
MIRT824501	hsa-miR-4644	CLIP-seq
MIRT824455	hsa-miR-4652-5p	CLIP-seq
MIRT824502	hsa-miR-4689	CLIP-seq
MIRT824503	hsa-miR-4693-5p	CLIP-seq
MIRT824504	hsa-miR-4704-3p	CLIP-seq
MIRT824505	hsa-miR-4711-3p	CLIP-seq
MIRT824506	hsa-miR-4730	CLIP-seq
MIRT824507	hsa-miR-4784	CLIP-seq
MIRT824508	hsa-miR-516b	CLIP-seq
MIRT824509	hsa-miR-548aa	CLIP-seq
MIRT824510	hsa-miR-592	CLIP-seq
MIRT824511	hsa-miR-599	CLIP-seq
MIRT824512	hsa-miR-635	CLIP-seq
MIRT824513	hsa-miR-767-3p	CLIP-seq
MIRT824514	hsa-miR-885-3p	CLIP-seq
MIRT824515	hsa-miR-891a	CLIP-seq
MIRT824516	hsa-miR-892a	CLIP-seq
MIRT824513	hsa-miR-767-3p	CLIP-seq
MIRT1943706	hsa-miR-4747-5p	CLIP-seq
MIRT1943707	hsa-miR-1202	CLIP-seq
MIRT824483	hsa-miR-1228	CLIP-seq
MIRT824484	hsa-miR-1231	CLIP-seq
MIRT824485	hsa-miR-1253	CLIP-seq
MIRT1943708	hsa-miR-1281	CLIP-seq
MIRT1943709	hsa-miR-1286	CLIP-seq
MIRT1943710	hsa-miR-141	CLIP-seq
MIRT824487	hsa-miR-1914	CLIP-seq
MIRT1943711	hsa-miR-200a	CLIP-seq
MIRT1943712	hsa-miR-204	CLIP-seq
MIRT1943713	hsa-miR-211	CLIP-seq
MIRT824488	hsa-miR-2964a-5p	CLIP-seq
MIRT824489	hsa-miR-3123	CLIP-seq
MIRT824492	hsa-miR-3150b-3p	CLIP-seq
MIRT1943714	hsa-miR-3688-3p	CLIP-seq
MIRT1943715	hsa-miR-3972	CLIP-seq
MIRT1943716	hsa-miR-3978	CLIP-seq
MIRT824495	hsa-miR-4289	CLIP-seq
MIRT1943717	hsa-miR-4307	CLIP-seq
MIRT824497	hsa-miR-4318	CLIP-seq
MIRT824498	hsa-miR-4434	CLIP-seq
MIRT1943718	hsa-miR-4436a	CLIP-seq
MIRT824499	hsa-miR-4516	CLIP-seq
MIRT824500	hsa-miR-4519	CLIP-seq
MIRT1943719	hsa-miR-4651	CLIP-seq
MIRT824502	hsa-miR-4689	CLIP-seq
MIRT824503	hsa-miR-4693-5p	CLIP-seq
MIRT824504	hsa-miR-4704-3p	CLIP-seq
MIRT824505	hsa-miR-4711-3p	CLIP-seq
MIRT1943720	hsa-miR-4721	CLIP-seq
MIRT824506	hsa-miR-4730	CLIP-seq
MIRT1943721	hsa-miR-4757-5p	CLIP-seq
MIRT824507	hsa-miR-4784	CLIP-seq
MIRT824471	hsa-miR-4797-5p	CLIP-seq
MIRT824508	hsa-miR-516b	CLIP-seq
MIRT824509	hsa-miR-548aa	CLIP-seq
MIRT824510	hsa-miR-592	CLIP-seq
MIRT824511	hsa-miR-599	CLIP-seq
MIRT1943722	hsa-miR-600	CLIP-seq
MIRT824513	hsa-miR-767-3p	CLIP-seq
MIRT824514	hsa-miR-885-3p	CLIP-seq
MIRT824515	hsa-miR-891a	CLIP-seq
MIRT824516	hsa-miR-892a	CLIP-seq
MIRT824461	hsa-miR-4708-5p	CLIP-seq
MIRT2182449	hsa-miR-668	CLIP-seq
MIRT824483	hsa-miR-1228	CLIP-seq
MIRT1943708	hsa-miR-1281	CLIP-seq
MIRT1943709	hsa-miR-1286	CLIP-seq
MIRT1943710	hsa-miR-141	CLIP-seq
MIRT1943711	hsa-miR-200a	CLIP-seq
MIRT824492	hsa-miR-3150b-3p	CLIP-seq
MIRT2182450	hsa-miR-329	CLIP-seq
MIRT1943718	hsa-miR-4436a	CLIP-seq
MIRT2182451	hsa-miR-4447	CLIP-seq
MIRT2182452	hsa-miR-4472	CLIP-seq
MIRT2182453	hsa-miR-4659a-5p	CLIP-seq
MIRT2182454	hsa-miR-4659b-5p	CLIP-seq
MIRT824502	hsa-miR-4689	CLIP-seq
MIRT824507	hsa-miR-4784	CLIP-seq
MIRT824513	hsa-miR-767-3p	CLIP-seq
MIRT824514	hsa-miR-885-3p	CLIP-seq
MIRT1943707	hsa-miR-1202	CLIP-seq
MIRT824483	hsa-miR-1228	CLIP-seq
MIRT2384877	hsa-miR-2052	CLIP-seq
MIRT1943715	hsa-miR-3972	CLIP-seq
MIRT2384878	hsa-miR-3973	CLIP-seq
MIRT1943717	hsa-miR-4307	CLIP-seq
MIRT2182451	hsa-miR-4447	CLIP-seq
MIRT2182452	hsa-miR-4472	CLIP-seq
MIRT2384879	hsa-miR-4776-3p	CLIP-seq
MIRT2384880	hsa-miR-520g	CLIP-seq
MIRT2384881	hsa-miR-520h	CLIP-seq
MIRT824484	hsa-miR-1231	CLIP-seq
MIRT824485	hsa-miR-1253	CLIP-seq
MIRT824489	hsa-miR-3123	CLIP-seq
MIRT824492	hsa-miR-3150b-3p	CLIP-seq
MIRT824498	hsa-miR-4434	CLIP-seq
MIRT824499	hsa-miR-4516	CLIP-seq
MIRT824505	hsa-miR-4711-3p	CLIP-seq
MIRT824507	hsa-miR-4784	CLIP-seq
MIRT824508	hsa-miR-516b	CLIP-seq
MIRT824510	hsa-miR-592	CLIP-seq
MIRT824511	hsa-miR-599	CLIP-seq
MIRT824484	hsa-miR-1231	CLIP-seq
MIRT824485	hsa-miR-1253	CLIP-seq
MIRT824489	hsa-miR-3123	CLIP-seq
MIRT824492	hsa-miR-3150b-3p	CLIP-seq
MIRT824498	hsa-miR-4434	CLIP-seq
MIRT824499	hsa-miR-4516	CLIP-seq
MIRT824505	hsa-miR-4711-3p	CLIP-seq
MIRT824507	hsa-miR-4784	CLIP-seq
MIRT824508	hsa-miR-516b	CLIP-seq
MIRT824510	hsa-miR-592	CLIP-seq
MIRT824511	hsa-miR-599	CLIP-seq
MIRT824484	hsa-miR-1231	CLIP-seq
MIRT824485	hsa-miR-1253	CLIP-seq
MIRT824489	hsa-miR-3123	CLIP-seq
MIRT824492	hsa-miR-3150b-3p	CLIP-seq
MIRT824498	hsa-miR-4434	CLIP-seq
MIRT824499	hsa-miR-4516	CLIP-seq
MIRT824505	hsa-miR-4711-3p	CLIP-seq
MIRT824507	hsa-miR-4784	CLIP-seq
MIRT824508	hsa-miR-516b	CLIP-seq
MIRT824510	hsa-miR-592	CLIP-seq
MIRT824511	hsa-miR-599	CLIP-seq
MIRT824484	hsa-miR-1231	CLIP-seq
MIRT824485	hsa-miR-1253	CLIP-seq
MIRT824489	hsa-miR-3123	CLIP-seq
MIRT824492	hsa-miR-3150b-3p	CLIP-seq
MIRT824498	hsa-miR-4434	CLIP-seq
MIRT824499	hsa-miR-4516	CLIP-seq
MIRT824505	hsa-miR-4711-3p	CLIP-seq
MIRT824507	hsa-miR-4784	CLIP-seq
MIRT824508	hsa-miR-516b	CLIP-seq
MIRT824510	hsa-miR-592	CLIP-seq
MIRT824511	hsa-miR-599	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NPM1	Unknown	24220271

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IBA
GO:0000794	Component	Condensed nuclear chromosome	IDA	10938129
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	23086925
GO:0002039	Function	P53 binding	IDA	23317504
GO:0003682	Function	Chromatin binding	IBA
GO:0003682	Function	Chromatin binding	IDA	20871596, 23728299
GO:0003712	Function	Transcription coregulator activity	IMP	24360279
GO:0003713	Function	Transcription coactivator activity	IMP	21555454
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0005515	Function	Protein binding	IPI	17023018, 17189189, 17474147, 17690245, 18305892, 19103749, 20133580, 21555454, 22645123, 22761572, 23455924, 23686307, 23728299, 24360279, 24361270, 24525235, 24759320, 26659056, 28514442, 29176719, 29374058, 33961781, 35016035, 35182466, 35512704
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	20871596, 25593309
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IDA	23728299
GO:0005694	Component	Chromosome	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IBA
GO:0006338	Process	Chromatin remodeling	IDA	23728299
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IMP	18039861
GO:0006974	Process	DNA damage response	IEA
GO:0006974	Process	DNA damage response	IMP	23728299
GO:0008353	Function	RNA polymerase II CTD heptapeptide repeat kinase activity	IMP	22509028
GO:0010971	Process	Positive regulation of G2/M transition of mitotic cell cycle	IMP	10938129
GO:0019899	Function	Enzyme binding	IPI	21555454
GO:0030674	Function	Protein-macromolecule adaptor activity	IEA
GO:0032968	Process	Positive regulation of transcription elongation by RNA polymerase II	IDA	19103749
GO:0032968	Process	Positive regulation of transcription elongation by RNA polymerase II	IMP	18039861
GO:0042393	Function	Histone binding	IBA
GO:0042393	Function	Histone binding	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	19103749
GO:0043922	Process	Host-mediated suppression of viral transcription	IDA	17690245
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	21555454
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	23086925, 23317504, 24360279
GO:0050727	Process	Regulation of inflammatory response	IDA	19103749
GO:0099122	Function	RNA polymerase II C-terminal domain binding	IDA	22509028
GO:0106140	Function	P-TEFb complex binding	IDA	17690245, 24360279
GO:0140008	Function	Histone H4 reader activity	IDA	20871596, 23086925, 23317504, 29176719
GO:0140011	Function	Histone H4K12ac reader activity	IDA	29379197
GO:0140012	Function	Histone H4K5ac reader activity	IDA	29379197
GO:0140046	Function	Histone H4K16ac reader activity	IDA	29379197
GO:0140055	Function	Histone H4K8ac reader activity	IDA	29379197
GO:0140072	Function	Histone H3K9ac reader activity	IDA	29379197
GO:0140119	Function	Histone H3K27ac reader activity	IDA	23728299, 29379197
GO:2000002	Process	Negative regulation of DNA damage checkpoint	IMP	23728299
GO:2000330	Process	Positive regulation of T-helper 17 cell lineage commitment	ISS

Other IDs

• MIM: 608749
• HGNC: 13575
• e!Ensembl: ENSG00000141867

Protein

• UniProt ID: O60885
• Protein name: Bromodomain-containing protein 4 (Protein HUNK1)
• Protein function: Chromatin reader protein that recognizes and binds acetylated histones and plays a key role in transmission of epigenetic memory across cell divisions and transcription regulation (PubMed:20871596, PubMed:23086925, PubMed:23317504, PubMed:291767
• PDB: 2I8N, 2LSP, 2MJV, 2N3K, 2NCZ, 2ND0, 2ND1, 2NNU, 2OSS, 2OUO, 2YEL, 2YEM, 3MXF, 3P5O, 3SVF, 3SVG, 3U5J, 3U5K, 3U5L, 3UVW, 3UVX, 3UVY, 3UW9, 3ZYU, 4A9L, 4BJX, 4BW1, 4BW2, 4BW3, 4BW4, 4C66, 4C67, 4CFK, 4CFL, 4CL9, 4CLB, 4DON, 4E96, 4F3I, 4GPJ, 4HBV, 4HBW, 4HBX, 4HBY, 4HXK, 4HXL, 4HXM, 4HXN, 4HXO, 4HXP, 4HXR
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00439	Bromodomain	67 → 152	Bromodomain	Domain
  PF00439	Bromodomain	357 → 445	Bromodomain	Domain
  PF17035	BET	609 → 673	Bromodomain extra-terminal - transcription regulation	Domain
  PF17105	BRD4_CDT	1319 → 1362	C-terminal domain of bromodomain protein 4	Family

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:12543779}.
• Sequence:

  MSAESGPGTRLRNLPVMGDGLETSQMSTTQAQAQPQPANAASTNPPPPETSNPNKPKRQT
  NQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYW
  NAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEETEIMIVQAKGRG
  RGRKETGTAKPGVSTVPNTTQASTPPQTQTPQPNPPPVQATPHPFPAVTPDLIVQTPVMT
  VVPPQPLQTPPPVPPQPQPPPAPAPQPVQSHPPIIAATPQPVKTKKGVKRKADTTTPTTI
  DPIHEPPSLPPEPKTTKLGQRRESSRPVKPPKKDVPDSQQHPAPEKSSKVSEQLKCCSGI
  LKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGA
  DVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPEEPVVAVSSPAVPPPTKVV
  APPSSSDSSSDSSSDSDSSTDDSEEERAQRLAELQEQLKAVHEQLAALSQPQQNKPKKKE
  KDKKEKKKEKHKRKEEVEENKKSKAKEPPPKKTKKNNSSNSNVSKKEPAPMKSKPPPTYE
  SEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLK
  PSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSSSESESSSESSSSDSEDSETE
  MAPKSKKKGHPGREQKKHHHHHHQQMQQAPAPVPQQPPPPPQQPPPPPPPQQQQQPPPPP
  PPPSMPQQAAPAMKSSPPPFIATQVPVLEPQLPGSVFDPIGHFTQPILHLPQPELPPHLP
  QPPEHSTPPHLNQHAVVSPPALHNALPQQPSRPSNRAAALPPKPARPPAVSPALTQTPLL
  PQPPMAQPPQVLLEDEEPPAPPLTSMQMQLYLQQLQKVQPPTPLLPSVKVQSQPPPPLPP
  PPHPSVQQQLQQQPPPPPPPQPQPPPQQQHQPPPRPVHLQPMQFSTHIQQPPPPQGQQPP
  HPPPGQQPPPPQPAKPQQVIQHHHSPRHHKSDPYSTGHLREAPSPLMIHSPQMSQFQSLT
  HQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPIIRSEPFSPSLRPEPPKHPESI
  KAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPPGAPDKDKQKQEPKTPVAPKKDLKIKNMG
  SWASLVQKHPTTPSSTAKSSSDSFEQFRRAAREKEEREKALKAQAEHAEKEKERLRQERM
  RSREDEDALEQARRAHEEARRRQEQQQQQRQEQQQQQQQQAAAVAAAATPQAQSSQPQSM
  LDQQRELARKREQERRRREAMAATIDMNFQSDLLSIFEENLF

• Sequence length: 1362

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Cornelia de Lange syndrome 6	Likely pathogenic; Pathogenic	rs2512579975, rs2512580369, rs2512711994, rs2512705724, rs868796773, rs2047523428	RCV003448989 RCV003449003 RCV003449004 RCV003764456 RCV003764467 RCV004799341	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Cornelia de Lange-like syndrome	Likely pathogenic	rs2512706092	RCV003225266	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
De Lange syndrome	Pathogenic	rs2145497734	RCV002249318	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual disability	Pathogenic	rs2512703983	RCV002287595	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Mental disorder	Likely pathogenic	rs752500721	RCV003985063	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Short stature	Likely pathogenic	rs1568383758, rs1599473950	RCV000736205 RCV000986204	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Syndromic intellectual disability	Likely pathogenic	rs2145499914	RCV002275374	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Thyroid cancer, nonmedullary, 1	Pathogenic	rs2145497734	RCV005930056	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Uterine corpus endometrial carcinoma	Pathogenic	rs2145497734	RCV005930057	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BRD4-related disorder	Likely benign; Benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORNELIA DE LANGE SYNDROME	—	Disgenet, GWAS catalog, Orphanet Disgenet, GWAS catalog, Orphanet Disgenet, GWAS catalog, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cornelia de Lange syndrome 1	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Developmental disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERPLASIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION, PULMONARY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC PULMONARY FIBROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Learning Disabilities, Adolescent	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEDULLOBLASTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental disorder	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOSARCOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC KIDNEY DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC KIDNEY, AUTOSOMAL DOMINANT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	29456727		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	30552662, 31220668		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	35765893	Associate	★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	36793283	Stimulate	★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	23249862		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	CTD_human_DG	24231268		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	24796395, 26814967, 30611741, 31594641		★☆☆☆☆ Found in Text Mining only
Allergic sensitization	Allergic Sensitization	BEFREE	28477791		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	CTD_human_DG	25242322		★☆☆☆☆ Found in Text Mining only
Alopecia, Male Pattern	Alopecia, Male Pattern	CTD_human_DG	25242322		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	35248531	Associate	★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	25284786		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	29717765		★☆☆☆☆ Found in Text Mining only
Androgenetic Alopecia	Androgenetic Alopecia	CTD_human_DG	25242322		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	24807963, 25647019, 28369619, 31126889		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	35096137	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	30784214		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	2624428		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	26989780		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	33717143, 35494514	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	BEFREE	31789032		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	22913580, 29748248		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	31300040	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30463877		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	30463877	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	25656449, 30272279		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	1643026		★☆☆☆☆ Found in Text Mining only
Beta thalassemia intermedia	beta Thalassemia	BEFREE	26418075		★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	1643026		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	26939702		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18427120, 19289584, 19369627, 19864236, 21389092, 24698965, 25367072, 25818873, 26473483, 26754674, 26771497, 27180259, 27455837, 27622335, 27651315, 28359301, 28764718, 28927100, 28981843, 29172540, 29493812, 29792310, 30029633, 30518851, 30720865, 30953146, 31076089, 31114028, 31452730, 31732618		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19706770, 25001387, 25788266, 26771497, 27651315, 28359301, 28846832, 28981843, 30029633, 31886177, 32321829, 32799413, 33006750, 33099470, 33617509, 35105803, 36124682, 40696656	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	23317504		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	23317504, 26051217	Associate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	30476723	Associate	★☆☆☆☆ Found in Text Mining only
Capillary malformation (disorder)	Capillary malformation	BEFREE	25557259		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21652721, 25120803, 27624132, 28481868, 28630312, 32954665, 35105803, 37737256	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15483023, 17329240, 24736545, 26027633, 26976114		★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	28545522	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25816404, 27081696, 34173348, 35514200, 35546353, 36193305, 37880710	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	26939702		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25284786, 29333921, 30232453, 31621555		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	31043489	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	24807963	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32303673, 35918352, 36364277	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	37119804	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25133707, 25535366, 25892415, 26877780, 28983974, 30036377, 30420565, 31043489, 31534014		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30879350, 31042405, 31257080		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	30879350	Associate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central nervous system neoplasm	Pubtator	36934287	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	40605044	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	31806131		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30421459		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30421459		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	23249862		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	CTD_human_DG	24231268		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	24796395, 26814967, 30611741, 31594641		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	31632543		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	30824188		★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	30241450		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	29386193		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	26044852, 30652495		★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	26913922	Associate	★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	31257080		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30144577		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22120039, 26586936, 26752646		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	26752646		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25603177, 30674532, 30933440, 31523195, 31734632, 31832310		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29507187, 31734632, 32100443, 34290255, 34819668, 35159127, 36781122	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	16368518		★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	GENOMICS_ENGLAND_DG	30302754		★☆☆☆☆ Found in Text Mining only
Congenital muscular hypertrophy-cerebral syndrome	Congenital Muscular Hypertrophy-Cerebral Syndrome	CTD_human_DG	29379197		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28636361, 29352508, 30529546, 31409188		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28391274, 29228703, 29796168, 30308518, 30385738		★☆☆☆☆ Found in Text Mining only
Cornelia De Lange Syndrome	Cornelia De Lange Syndrome	BEFREE	29379197, 30302754, 31320616		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cornelia De Lange Syndrome	Cornelia De Lange Syndrome	CTD_human_DG	29379197		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cornelia de Lange Syndrome 1	Cornelia De Lange Syndrome	CTD_human_DG	29379197		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Cornelia de Lange Syndrome 3	Cornelia De Lange Syndrome	CTD_human_DG	29379197		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	28473439		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	27240956		★☆☆☆☆ Found in Text Mining only
De Lange Syndrome	De lange syndrome	Pubtator	35470444, 39983729	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Degenerative polyarthritis	Arthritis	BEFREE	28844955, 29878401		★☆☆☆☆ Found in Text Mining only
Desmoplastic Medulloblastoma	Medulloblastoma	CTD_human_DG	24231268		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	31911672	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	31612634		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	31612634		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	33148187	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	38034011	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28225806		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	30386303, 31325480		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	31217338, 31527063		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	38513239	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	27572308, 28805821		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	32877461, 35226658	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	31638258		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	25133707, 31043489, 31534014		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	34160902	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36933111, 37676642, 40124272	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	30528103		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	29898995		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	29108123		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	27639088, 30745801		★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	28823556		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	28766687		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	31819043		★☆☆☆☆ Found in Text Mining only
Giant Cell Glioblastoma	Giant Cell Glioblastoma	CTD_human_DG	26455392, 27388964		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24496381, 28555065		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	CTD_human_DG	26455392, 27388964		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma Multiforme	Glioblastoma	BEFREE	24496381, 28555065, 31485609		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	CTD_human_DG	26455392, 27388964		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28484091, 29568956, 31485609, 31724259		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	36224471	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	37272763	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	28535045		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28636361, 29352508, 30529546, 31409188		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	33016928	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	27573426, 27858214, 30532520, 30842097		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	30532520	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	28694331	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	21858921		★☆☆☆☆ Found in Text Mining only
Hypersomnia	Hypersomnia	BEFREE	29631952		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	33148187	Associate	★☆☆☆☆ Found in Text Mining only
hypertensive nephropathy	Hypertensive Nephropathy	BEFREE	31356816		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	26224795, 27246590, 28473439, 31042405, 31749139		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	23759512		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual Disability	Mental retardation	GENOMICS_ENGLAND_DG	30302754		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	31331201		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	22645123		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	39273015	Stimulate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	21814200, 22829075, 25369933, 25982114, 27294782, 28146632, 28490802, 30015487, 30529546, 30690335, 30761268, 30829648, 31421967		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	25989842, 26055303, 28490802	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Leukemia Mast Cell	Mast cell leukemia	Pubtator	26055303	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	23317504, 23517011, 25989842, 27291650, 27764789, 30568163, 31266503, 34016956, 34358447, 34793513, 35264812, 35832114, 35842703, 37055414	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	33796404	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia, Mast-Cell	Leukemia	BEFREE	26055303		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	21814200, 23249862, 23317504, 24065765, 24220271, 24435446, 25982114, 26626481, 28146632, 28694331, 29563491, 30568163, 30690335, 30761268, 31697807, 31708096		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16368518, 23742296, 25816404, 26456956, 26575167, 27081696, 29777702, 30172011, 30659195, 30723918		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	27793799		★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	31733396		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	30232453		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31621555	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31908099, 31908141, 34173348, 34400879	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	26590112		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	26590112		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	26590112		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	26590112		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25120803, 36352160	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26840017	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	31633227		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	30076183, 31813613		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	30076183, 34252226	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	29180399, 30876800		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	30348538		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	29764999		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18427120, 19289584, 19369627, 19864236, 21389092, 24504069, 25367072, 25818873, 26223814, 26473483, 26754674, 26771497, 26820945, 27180259, 27455837, 27622335, 27651315, 27716627, 28359301, 28764718, 28927100, 28981843, 29172540, 29493812, 29792310, 30029633, 30518851, 30520947, 30720865, 31076089, 31114028, 31452730, 31732618		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	28805821		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	28766687, 31215139		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	27081696		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15994877, 25284786, 27604143, 29333921, 30232453, 31621555		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25535366, 25892415, 26877780, 28983974, 30036377, 30420565		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25807524, 30664982, 30709380, 31718704		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24763052, 27223260, 28359301, 28591577, 28805820, 28917266, 29108467, 29133261, 29346775, 29555663, 29716963, 30272279, 30308485, 30846826, 30921702, 31130467		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	24763052		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28681984, 29901187, 31311807, 31837602		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	26939702		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21814200, 23317504, 23543289, 23686307, 24464224, 24551292, 24759320, 24763052, 25877301, 26035625, 26402248, 26939702, 27055867, 27081696, 27084101, 27250788, 27494802, 27573426, 27846392, 27858214, 28195723, 28515341, 28545522, 28591577, 28630312, 28681984, 28901664, 28939121, 29187284, 29189147, 29346775, 29386193, 29434197, 29540837, 29568956, 29603290, 29717765, 29792310, 29941841, 30029633, 30036377, 30057199, 30253095, 30385738, 30420565, 30457858, 30466442, 30529546, 30539410, 30542529, 30552662, 30832981, 30842097, 30846826, 30876979, 30879350, 30926312, 30988278, 31018997, 31114028, 31133746, 31215391, 31257080, 31311807, 31523195, 31553577, 31587361, 31633227, 31708096, 31718704, 31765738, 31789405, 31815566, 31837433		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	25352098, 28813519, 30796033, 31023785		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30421459		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22120039, 26586936, 26752646, 29176719		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	26752646		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	30241820		★☆☆☆☆ Found in Text Mining only
Mannose-Binding Protein Deficiency	Mannose-Binding Protein Deficiency	BEFREE	22523362		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	30348538		★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	26055303	Associate	★☆☆☆☆ Found in Text Mining only
Mastocytosis, Systemic	Mastocytosis	BEFREE	26055303		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	CTD_human_DG	24231268		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medulloblastoma	Medulloblastoma	BEFREE	24796395, 26814967, 30611741, 31594641		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medulloblastoma	Medulloblastoma	Pubtator	36273157	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medullomyoblastoma	Medullomyoblastoma	CTD_human_DG	24231268		★☆☆☆☆ Found in Text Mining only
Megalencephaly cutis marmorata telangiectatica congenita	Megalencephaly Cutis Marmorata Telangiectatica Congenita	BEFREE	29549527		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	23950209		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	29149598, 33504439, 34252226	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	34252226	Associate	★☆☆☆☆ Found in Text Mining only
Melanotic medulloblastoma	Medulloblastoma	CTD_human_DG	24231268		★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	25941994		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	GENOMICS_ENGLAND_DG	30302754		★☆☆☆☆ Found in Text Mining only
Mitochondrial complex I deficiency	Mitochondrial complex deficiency	Pubtator	27666594, 27716487	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	27666594		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	27666594, 34252226	Associate	★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	19279216		★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	30539410		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	23317504, 23582323, 32762714, 32992461, 33186461, 36121114	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	23582323, 28115161, 29048129, 29581547, 30529546, 31712391		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophies, Limb-Girdle	Limb-Girdle Muscular Dystrophy	BEFREE	30564623		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	29563491, 30761268		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	29563491	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29352508		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10440809, 17329240, 18427120, 22120039, 23686307, 24736545, 24796395, 24807963, 25284786, 25537515, 25647019, 25816404, 26220994, 26575167, 26939702, 26976114, 27180259, 27572308, 27573426, 27769070, 28032917, 28137841, 28192599, 28339196, 28391274, 29050985, 29133261, 29180399, 29525435, 29540837, 29716963, 29717765, 30015945, 30029633, 30272279, 30308518, 30420565, 30520947, 30606676, 30988278, 31018997, 31213835, 31375912, 31470872, 31633227, 31819043		★☆☆☆☆ Found in Text Mining only
Nephrocalcinosis	Nephrocalcinosis	BEFREE	30830987		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	27858214		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28881723, 30153557		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	30789735	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	28281917		★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	28813519		★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	28813519		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	28813519	Associate	★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	28077651, 29694891		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	29108123		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26840017, 29333921, 29792310, 31199520, 31213835		★☆☆☆☆ Found in Text Mining only
NUT midline carcinoma	Carcinoma	BEFREE	19363441, 21652721, 22301500, 23128391, 23604113, 24326851, 24736545, 24875858, 26220994, 26402248, 26976114, 27698495, 28426098, 28484033, 28525743, 28630312, 28930680, 28967088, 29348827, 29540837, 29700887, 30139738, 30307375, 30782401		★☆☆☆☆ Found in Text Mining only
NUT midline carcinoma	Carcinoma	ORPHANET_DG	22017582		★☆☆☆☆ Found in Text Mining only
NUT midline carcinoma	Carcinoma	Orphanet			★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	30879350	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28032455		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	37980502	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	CTD_human_DG	24646477		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	BEFREE	30286779		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	Pubtator	30476723	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	25535366, 25892415		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26877780, 28983974, 30036377, 30420565		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26864203, 27452461, 32044108, 32629664, 33686960, 34252226, 36753396, 37060086, 37737256	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25807524, 30664982, 30709380, 31718704		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	25647019, 30664982		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25807524, 32893006, 34252226, 37096681, 37831776	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic squamous cell carcinoma	Pancreatic Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pancreatoblastoma	Pancreatoblastoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	30015945		★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	23402025		★☆☆☆☆ Found in Text Mining only
Perry Syndrome	Perry Syndrome	BEFREE	19136952, 20518521		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	31774020		★☆☆☆☆ Found in Text Mining only
Plexiform Neurofibroma	Plexiform neurofibroma	BEFREE	28813519		★☆☆☆☆ Found in Text Mining only
Polycystic kidney disease, type 2	Polycystic kidney disease	CTD_human_DG	25877301		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	25877301		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	CTD_human_DG	25877301		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Kidney, Type 1 Autosomal Dominant Disease	Polycystic kidney disease	CTD_human_DG	25877301		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	24394663		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27223260, 28359301, 28591577, 28805820, 28917266, 29108467, 29133261, 29346775, 29555663, 29716963, 30272279, 30308485, 30846826, 30921702, 31130467		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	24763052		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27223260, 28359301, 28805820, 28805822, 29108467, 29346775, 32690869, 33654218, 37828515	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	31303963		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pseudopelade	Pseudopelade	CTD_human_DG	25242322		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	31059052		★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	26224795		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	37516840	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	30652495, 33833509, 33854310	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	37533154	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	23115324, 23759512, 27793799		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28391274, 29228703, 30308518, 30385738		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	28063381, 31215391		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	29914080		★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid Tumor	BEFREE	28426098, 29156698		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Alveolar	Rhabdomyosarcoma	Pubtator	36232302	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	25467295, 26093279		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	35182012, 37533154	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	24736545, 28359301	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	28359301		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	32669118, 35194152, 37390276	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24875858, 31037138		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29792310, 32961679, 35705032, 35923111, 36333293, 38014458, 38606512	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	29050985		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	29792310, 30250532, 31765738		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	31633227		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29108123, 29463916, 31295293, 31377187, 31807383		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28415703, 28681984, 29901187, 31311807, 31837602		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28415703, 28481868, 29434197, 32820150, 36352160	Associate	★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	34997561	Associate	★☆☆☆☆ Found in Text Mining only
Thymic Carcinoma	Thymic Carcinoma	BEFREE	30527189		★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	30527189		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	CTD_human_DG	26707881		★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	CTD_human_DG	26707881		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	CTD_human_DG	26707881		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	34956562	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	27651315, 30012592, 33006750, 34754068, 36499487, 38073442	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28108460, 28848040, 29437854, 30012592, 30259975		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25120803	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35167374	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33611824	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	26397223		★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	30476723	Associate	★☆☆☆☆ Found in Text Mining only