TARDBP (TAR DNA binding protein)

Gene

• Entrez ID: 23435
• Gene name: TAR DNA binding protein
• Gene symbol: TARDBP
• Synonyms (NCBI Gene): ALS10, TDP-43
• Chromosome: 1
• Chromosome location: 1p36.22
• Summary: HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs4884357	G>A,T	Pathogenic, pathogenic-likely-pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs80356717	A>G	Conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs80356718	A>G	Pathogenic	Missense variant, coding sequence variant
rs80356719	G>A,C	Likely-pathogenic, uncertain-significance, pathogenic	Missense variant, coding sequence variant
rs80356721	G>A,C,T	Pathogenic	Missense variant, coding sequence variant
rs80356723	G>A,C,T	Pathogenic	Missense variant, coding sequence variant
rs80356726	G>A	Pathogenic	Missense variant, coding sequence variant
rs80356727	C>A	Pathogenic	Missense variant, coding sequence variant
rs80356730	A>G	Pathogenic	Missense variant, coding sequence variant
rs80356731	A>G	Pathogenic	Missense variant, coding sequence variant
rs80356733	G>T	Pathogenic	Missense variant, coding sequence variant
rs80356734	A>G	Pathogenic	Missense variant, coding sequence variant
rs80356740	A>G	Pathogenic	Missense variant, coding sequence variant
rs80356744	T>C	Pathogenic	3 prime UTR variant
rs121908395	G>C,T	Pathogenic	Missense variant, coding sequence variant
rs201693535	C>T	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant
rs267607102	A>G	Pathogenic	Missense variant, coding sequence variant
rs367543041	G>A,C	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs387906334	G>A	Pathogenic	Intron variant, 3 prime UTR variant
rs797044594	G>C	Pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs797044595	T>G	Pathogenic	Missense variant, coding sequence variant
rs1131690782	G>T	Pathogenic	Missense variant, coding sequence variant
rs1570725499	T>A,C	Likely-pathogenic	Coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021204	hsa-miR-186-5p	Sequencing	20371350
MIRT026694	hsa-miR-192-5p	Microarray	19074876
MIRT046426	hsa-miR-15b-5p	CLASH	23622248
MIRT046010	hsa-miR-125b-5p	CLASH	23622248
MIRT038804	hsa-miR-93-3p	CLASH	23622248
MIRT036282	hsa-miR-1229-3p	CLASH	23622248
MIRT052712	hsa-miR-1260b	CLASH	23622248
MIRT437342	hsa-miR-8485	EMSA	23827811
MIRT711903	hsa-miR-877-3p	HITS-CLIP	19536157
MIRT711902	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT711901	hsa-miR-7111-3p	HITS-CLIP	19536157
MIRT711900	hsa-miR-6780a-3p	HITS-CLIP	19536157
MIRT711899	hsa-miR-6881-3p	HITS-CLIP	19536157
MIRT711898	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT711897	hsa-miR-1238-3p	HITS-CLIP	19536157
MIRT711903	hsa-miR-877-3p	HITS-CLIP	19536157
MIRT711902	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT711901	hsa-miR-7111-3p	HITS-CLIP	19536157
MIRT711900	hsa-miR-6780a-3p	HITS-CLIP	19536157
MIRT711899	hsa-miR-6881-3p	HITS-CLIP	19536157
MIRT711898	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT711897	hsa-miR-1238-3p	HITS-CLIP	19536157
MIRT707637	hsa-miR-548n	HITS-CLIP	21572407
MIRT707636	hsa-miR-548av-5p	HITS-CLIP	21572407
MIRT707635	hsa-miR-548k	HITS-CLIP	21572407
MIRT707634	hsa-miR-8054	HITS-CLIP	21572407
MIRT707633	hsa-miR-3529-3p	HITS-CLIP	21572407
MIRT707632	hsa-miR-3123	HITS-CLIP	21572407
MIRT707631	hsa-miR-3613-3p	HITS-CLIP	21572407
MIRT707630	hsa-miR-3919	HITS-CLIP	21572407
MIRT707629	hsa-miR-520d-5p	HITS-CLIP	21572407
MIRT707628	hsa-miR-524-5p	HITS-CLIP	21572407
MIRT652817	hsa-miR-4698	HITS-CLIP	23824327
MIRT652816	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT652817	hsa-miR-4698	HITS-CLIP	23824327
MIRT652816	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT264534	hsa-miR-4282	PAR-CLIP	20371350
MIRT574277	hsa-miR-7153-3p	PAR-CLIP	20371350
MIRT574276	hsa-miR-183-3p	PAR-CLIP	20371350
MIRT574275	hsa-miR-4452	PAR-CLIP	20371350
MIRT264533	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT178873	hsa-miR-4311	PAR-CLIP	20371350
MIRT178872	hsa-miR-1276	PAR-CLIP	20371350
MIRT178871	hsa-miR-583	PAR-CLIP	20371350
MIRT178874	hsa-miR-7846-3p	PAR-CLIP	20371350
MIRT331690	hsa-miR-1302	PAR-CLIP	20371350
MIRT331691	hsa-miR-4298	PAR-CLIP	20371350
MIRT264533	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT178873	hsa-miR-4311	PAR-CLIP	20371350
MIRT178872	hsa-miR-1276	PAR-CLIP	20371350
MIRT178871	hsa-miR-583	PAR-CLIP	20371350
MIRT178874	hsa-miR-7846-3p	PAR-CLIP	20371350
MIRT331690	hsa-miR-1302	PAR-CLIP	20371350
MIRT331691	hsa-miR-4298	PAR-CLIP	20371350
MIRT264533	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT178873	hsa-miR-4311	PAR-CLIP	20371350
MIRT178872	hsa-miR-1276	PAR-CLIP	20371350
MIRT178871	hsa-miR-583	PAR-CLIP	20371350
MIRT178874	hsa-miR-7846-3p	PAR-CLIP	20371350
MIRT331690	hsa-miR-1302	PAR-CLIP	20371350
MIRT331691	hsa-miR-4298	PAR-CLIP	20371350
MIRT264533	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT178873	hsa-miR-4311	PAR-CLIP	20371350
MIRT178872	hsa-miR-1276	PAR-CLIP	20371350
MIRT178871	hsa-miR-583	PAR-CLIP	20371350
MIRT178874	hsa-miR-7846-3p	PAR-CLIP	20371350
MIRT331690	hsa-miR-1302	PAR-CLIP	20371350
MIRT331691	hsa-miR-4298	PAR-CLIP	20371350
MIRT264533	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT178873	hsa-miR-4311	PAR-CLIP	21572407
MIRT178872	hsa-miR-1276	PAR-CLIP	21572407
MIRT178871	hsa-miR-583	PAR-CLIP	21572407
MIRT178874	hsa-miR-7846-3p	PAR-CLIP	21572407
MIRT331690	hsa-miR-1302	PAR-CLIP	21572407
MIRT331691	hsa-miR-4298	PAR-CLIP	21572407
MIRT264533	hsa-miR-548c-3p	PAR-CLIP	23446348
MIRT178873	hsa-miR-4311	PAR-CLIP	23446348
MIRT178872	hsa-miR-1276	PAR-CLIP	23446348
MIRT178871	hsa-miR-583	PAR-CLIP	23446348
MIRT178874	hsa-miR-7846-3p	PAR-CLIP	23446348
MIRT331690	hsa-miR-1302	PAR-CLIP	23446348
MIRT331691	hsa-miR-4298	PAR-CLIP	23446348
MIRT264533	hsa-miR-548c-3p	PAR-CLIP	23446348
MIRT178873	hsa-miR-4311	PAR-CLIP	23446348
MIRT178872	hsa-miR-1276	PAR-CLIP	23446348
MIRT178871	hsa-miR-583	PAR-CLIP	23446348
MIRT178874	hsa-miR-7846-3p	PAR-CLIP	23446348
MIRT331690	hsa-miR-1302	PAR-CLIP	23446348
MIRT331691	hsa-miR-4298	PAR-CLIP	23446348
MIRT466623	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT466622	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT466621	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT466620	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT466619	hsa-miR-6805-5p	PAR-CLIP	23592263
MIRT466618	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT466617	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT466616	hsa-miR-5698	PAR-CLIP	23592263
MIRT466615	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT466614	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT466613	hsa-miR-4278	PAR-CLIP	23592263
MIRT466612	hsa-miR-513a-5p	PAR-CLIP	23592263
MIRT466623	hsa-miR-27a-3p	Luciferase reporter assay, Western blotting, Immunofluorescence, qRT-PCR, Flow cytometry	31452277
MIRT711903	hsa-miR-877-3p	HITS-CLIP	19536157
MIRT711902	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT711901	hsa-miR-7111-3p	HITS-CLIP	19536157
MIRT711900	hsa-miR-6780a-3p	HITS-CLIP	19536157
MIRT711899	hsa-miR-6881-3p	HITS-CLIP	19536157
MIRT711898	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT711897	hsa-miR-1238-3p	HITS-CLIP	19536157
MIRT711903	hsa-miR-877-3p	HITS-CLIP	19536157
MIRT711902	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT711901	hsa-miR-7111-3p	HITS-CLIP	19536157
MIRT711900	hsa-miR-6780a-3p	HITS-CLIP	19536157
MIRT711899	hsa-miR-6881-3p	HITS-CLIP	19536157
MIRT711898	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT711897	hsa-miR-1238-3p	HITS-CLIP	19536157
MIRT707637	hsa-miR-548n	HITS-CLIP	21572407
MIRT707636	hsa-miR-548av-5p	HITS-CLIP	21572407
MIRT707635	hsa-miR-548k	HITS-CLIP	21572407
MIRT707634	hsa-miR-8054	HITS-CLIP	21572407
MIRT707633	hsa-miR-3529-3p	HITS-CLIP	21572407
MIRT707632	hsa-miR-3123	HITS-CLIP	21572407
MIRT707631	hsa-miR-3613-3p	HITS-CLIP	21572407
MIRT707630	hsa-miR-3919	HITS-CLIP	21572407
MIRT707629	hsa-miR-520d-5p	HITS-CLIP	21572407
MIRT707628	hsa-miR-524-5p	HITS-CLIP	21572407
MIRT652817	hsa-miR-4698	HITS-CLIP	23824327
MIRT652816	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT652817	hsa-miR-4698	HITS-CLIP	23824327
MIRT652816	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT264534	hsa-miR-4282	PAR-CLIP	20371350
MIRT574277	hsa-miR-7153-3p	PAR-CLIP	20371350
MIRT574276	hsa-miR-183-3p	PAR-CLIP	20371350
MIRT574275	hsa-miR-4452	PAR-CLIP	20371350
MIRT264533	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT178873	hsa-miR-4311	PAR-CLIP	20371350
MIRT178872	hsa-miR-1276	PAR-CLIP	20371350
MIRT178871	hsa-miR-583	PAR-CLIP	20371350
MIRT178874	hsa-miR-7846-3p	PAR-CLIP	20371350
MIRT331690	hsa-miR-1302	PAR-CLIP	20371350
MIRT331691	hsa-miR-4298	PAR-CLIP	20371350
MIRT264533	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT178873	hsa-miR-4311	PAR-CLIP	20371350
MIRT178872	hsa-miR-1276	PAR-CLIP	20371350
MIRT178871	hsa-miR-583	PAR-CLIP	20371350
MIRT178874	hsa-miR-7846-3p	PAR-CLIP	20371350
MIRT331690	hsa-miR-1302	PAR-CLIP	20371350
MIRT331691	hsa-miR-4298	PAR-CLIP	20371350
MIRT264533	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT178873	hsa-miR-4311	PAR-CLIP	20371350
MIRT178872	hsa-miR-1276	PAR-CLIP	20371350
MIRT178871	hsa-miR-583	PAR-CLIP	20371350
MIRT178874	hsa-miR-7846-3p	PAR-CLIP	20371350
MIRT331690	hsa-miR-1302	PAR-CLIP	20371350
MIRT331691	hsa-miR-4298	PAR-CLIP	20371350
MIRT264533	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT178873	hsa-miR-4311	PAR-CLIP	20371350
MIRT178872	hsa-miR-1276	PAR-CLIP	20371350
MIRT178871	hsa-miR-583	PAR-CLIP	20371350
MIRT178874	hsa-miR-7846-3p	PAR-CLIP	20371350
MIRT331690	hsa-miR-1302	PAR-CLIP	20371350
MIRT331691	hsa-miR-4298	PAR-CLIP	20371350
MIRT264533	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT178873	hsa-miR-4311	PAR-CLIP	21572407
MIRT178872	hsa-miR-1276	PAR-CLIP	21572407
MIRT178871	hsa-miR-583	PAR-CLIP	21572407
MIRT178874	hsa-miR-7846-3p	PAR-CLIP	21572407
MIRT331690	hsa-miR-1302	PAR-CLIP	21572407
MIRT331691	hsa-miR-4298	PAR-CLIP	21572407
MIRT264533	hsa-miR-548c-3p	PAR-CLIP	23446348
MIRT178873	hsa-miR-4311	PAR-CLIP	23446348
MIRT178872	hsa-miR-1276	PAR-CLIP	23446348
MIRT178871	hsa-miR-583	PAR-CLIP	23446348
MIRT178874	hsa-miR-7846-3p	PAR-CLIP	23446348
MIRT331690	hsa-miR-1302	PAR-CLIP	23446348
MIRT331691	hsa-miR-4298	PAR-CLIP	23446348
MIRT264533	hsa-miR-548c-3p	PAR-CLIP	23446348
MIRT178873	hsa-miR-4311	PAR-CLIP	23446348
MIRT178872	hsa-miR-1276	PAR-CLIP	23446348
MIRT178871	hsa-miR-583	PAR-CLIP	23446348
MIRT178874	hsa-miR-7846-3p	PAR-CLIP	23446348
MIRT331690	hsa-miR-1302	PAR-CLIP	23446348
MIRT331691	hsa-miR-4298	PAR-CLIP	23446348
MIRT466623	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT466622	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT466621	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT466620	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT466619	hsa-miR-6805-5p	PAR-CLIP	23592263
MIRT466618	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT466617	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT466616	hsa-miR-5698	PAR-CLIP	23592263
MIRT466615	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT466614	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT466613	hsa-miR-4278	PAR-CLIP	23592263
MIRT466612	hsa-miR-513a-5p	PAR-CLIP	23592263
MIRT1411406	hsa-miR-103a	CLIP-seq
MIRT1411407	hsa-miR-103b	CLIP-seq
MIRT1411408	hsa-miR-105	CLIP-seq
MIRT1411409	hsa-miR-107	CLIP-seq
MIRT1411410	hsa-miR-1179	CLIP-seq
MIRT1411411	hsa-miR-1184	CLIP-seq
MIRT1411412	hsa-miR-1197	CLIP-seq
MIRT1411413	hsa-miR-1273f	CLIP-seq
MIRT1411414	hsa-miR-1284	CLIP-seq
MIRT1411415	hsa-miR-1297	CLIP-seq
MIRT1411416	hsa-miR-143	CLIP-seq
MIRT1411417	hsa-miR-144	CLIP-seq
MIRT1411418	hsa-miR-181a	CLIP-seq
MIRT1411419	hsa-miR-181b	CLIP-seq
MIRT1411420	hsa-miR-181c	CLIP-seq
MIRT1411421	hsa-miR-181d	CLIP-seq
MIRT1411422	hsa-miR-183	CLIP-seq
MIRT1411423	hsa-miR-194	CLIP-seq
MIRT1411424	hsa-miR-1972	CLIP-seq
MIRT1411425	hsa-miR-203	CLIP-seq
MIRT1411426	hsa-miR-223	CLIP-seq
MIRT1411427	hsa-miR-2467-3p	CLIP-seq
MIRT1411428	hsa-miR-26a	CLIP-seq
MIRT1411429	hsa-miR-26b	CLIP-seq
MIRT1411430	hsa-miR-27a	CLIP-seq
MIRT1411431	hsa-miR-27b	CLIP-seq
MIRT1411432	hsa-miR-299-3p	CLIP-seq
MIRT1411433	hsa-miR-302a	CLIP-seq
MIRT1411434	hsa-miR-302b	CLIP-seq
MIRT1411435	hsa-miR-302c	CLIP-seq
MIRT1411436	hsa-miR-302d	CLIP-seq
MIRT1411437	hsa-miR-302e	CLIP-seq
MIRT1411438	hsa-miR-3074-3p	CLIP-seq
MIRT1411439	hsa-miR-3115	CLIP-seq
MIRT1411440	hsa-miR-3120-3p	CLIP-seq
MIRT1411441	hsa-miR-3121-3p	CLIP-seq
MIRT1411442	hsa-miR-3132	CLIP-seq
MIRT1411443	hsa-miR-3148	CLIP-seq
MIRT1411444	hsa-miR-3158-5p	CLIP-seq
MIRT1411445	hsa-miR-3163	CLIP-seq
MIRT1411446	hsa-miR-329	CLIP-seq
MIRT1411447	hsa-miR-331-3p	CLIP-seq
MIRT1411448	hsa-miR-337-3p	CLIP-seq
MIRT1411449	hsa-miR-340	CLIP-seq
MIRT1411450	hsa-miR-3545-3p	CLIP-seq
MIRT1411451	hsa-miR-3614-5p	CLIP-seq
MIRT1411452	hsa-miR-3616-5p	CLIP-seq
MIRT1411453	hsa-miR-362-3p	CLIP-seq
MIRT1411454	hsa-miR-3647-5p	CLIP-seq
MIRT1411455	hsa-miR-3653	CLIP-seq
MIRT1411456	hsa-miR-3658	CLIP-seq
MIRT1411457	hsa-miR-3678-3p	CLIP-seq
MIRT1411458	hsa-miR-372	CLIP-seq
MIRT1411459	hsa-miR-373	CLIP-seq
MIRT1411460	hsa-miR-376a	CLIP-seq
MIRT1411461	hsa-miR-376b	CLIP-seq
MIRT1411462	hsa-miR-378g	CLIP-seq
MIRT1411463	hsa-miR-3925-5p	CLIP-seq
MIRT1411464	hsa-miR-3936	CLIP-seq
MIRT1411465	hsa-miR-3977	CLIP-seq
MIRT1411466	hsa-miR-4262	CLIP-seq
MIRT1411467	hsa-miR-4292	CLIP-seq
MIRT1411468	hsa-miR-4299	CLIP-seq
MIRT1411469	hsa-miR-4310	CLIP-seq
MIRT1411470	hsa-miR-4328	CLIP-seq
MIRT1411471	hsa-miR-4418	CLIP-seq
MIRT1411472	hsa-miR-4422	CLIP-seq
MIRT1411473	hsa-miR-4436a	CLIP-seq
MIRT1411474	hsa-miR-4437	CLIP-seq
MIRT1411475	hsa-miR-4448	CLIP-seq
MIRT1411476	hsa-miR-4461	CLIP-seq
MIRT1411477	hsa-miR-4465	CLIP-seq
MIRT1411478	hsa-miR-4474-5p	CLIP-seq
MIRT1411479	hsa-miR-4477b	CLIP-seq
MIRT1411480	hsa-miR-4480	CLIP-seq
MIRT1411481	hsa-miR-4493	CLIP-seq
MIRT1411482	hsa-miR-4495	CLIP-seq
MIRT1411483	hsa-miR-4635	CLIP-seq
MIRT1411484	hsa-miR-4645-3p	CLIP-seq
MIRT1411485	hsa-miR-4668-3p	CLIP-seq
MIRT1411486	hsa-miR-4672	CLIP-seq
MIRT1411487	hsa-miR-4674	CLIP-seq
MIRT1411488	hsa-miR-4680-5p	CLIP-seq
MIRT1411489	hsa-miR-4685-5p	CLIP-seq
MIRT1411490	hsa-miR-4697-3p	CLIP-seq
MIRT1411491	hsa-miR-4700-3p	CLIP-seq
MIRT1411492	hsa-miR-4708-5p	CLIP-seq
MIRT1411493	hsa-miR-4756-3p	CLIP-seq
MIRT1411494	hsa-miR-4768-3p	CLIP-seq
MIRT1411495	hsa-miR-4770	CLIP-seq
MIRT1411496	hsa-miR-4773	CLIP-seq
MIRT1411497	hsa-miR-4795-5p	CLIP-seq
MIRT1411498	hsa-miR-491-3p	CLIP-seq
MIRT1411499	hsa-miR-499-3p	CLIP-seq
MIRT1411500	hsa-miR-499a-3p	CLIP-seq
MIRT1411501	hsa-miR-501-3p	CLIP-seq
MIRT1411502	hsa-miR-502-3p	CLIP-seq
MIRT1411503	hsa-miR-509-3-5p	CLIP-seq
MIRT1411504	hsa-miR-5095	CLIP-seq
MIRT1411505	hsa-miR-509-5p	CLIP-seq
MIRT1411506	hsa-miR-520a-3p	CLIP-seq
MIRT1411507	hsa-miR-520b	CLIP-seq
MIRT1411508	hsa-miR-520c-3p	CLIP-seq
MIRT1411509	hsa-miR-520d-3p	CLIP-seq
MIRT1411510	hsa-miR-520e	CLIP-seq
MIRT1411511	hsa-miR-520f	CLIP-seq
MIRT1411512	hsa-miR-545	CLIP-seq
MIRT1411513	hsa-miR-549	CLIP-seq
MIRT1411514	hsa-miR-573	CLIP-seq
MIRT1411515	hsa-miR-587	CLIP-seq
MIRT1411516	hsa-miR-642b	CLIP-seq
MIRT1411517	hsa-miR-802	CLIP-seq
MIRT1411518	hsa-miR-885-5p	CLIP-seq
MIRT1411415	hsa-miR-1297	CLIP-seq
MIRT1411428	hsa-miR-26a	CLIP-seq
MIRT1411429	hsa-miR-26b	CLIP-seq
MIRT1411465	hsa-miR-3977	CLIP-seq
MIRT1411468	hsa-miR-4299	CLIP-seq
MIRT1411477	hsa-miR-4465	CLIP-seq
MIRT1411488	hsa-miR-4680-5p	CLIP-seq
MIRT1411410	hsa-miR-1179	CLIP-seq
MIRT2123514	hsa-miR-1224-3p	CLIP-seq
MIRT2123515	hsa-miR-1260	CLIP-seq
MIRT2123516	hsa-miR-1264	CLIP-seq
MIRT2123517	hsa-miR-1280	CLIP-seq
MIRT1411415	hsa-miR-1297	CLIP-seq
MIRT1411418	hsa-miR-181a	CLIP-seq
MIRT1411419	hsa-miR-181b	CLIP-seq
MIRT1411420	hsa-miR-181c	CLIP-seq
MIRT1411421	hsa-miR-181d	CLIP-seq
MIRT2123518	hsa-miR-186	CLIP-seq
MIRT2123519	hsa-miR-188-3p	CLIP-seq
MIRT2123520	hsa-miR-188-5p	CLIP-seq
MIRT2123521	hsa-miR-1910	CLIP-seq
MIRT1411423	hsa-miR-194	CLIP-seq
MIRT2123522	hsa-miR-1976	CLIP-seq
MIRT2123523	hsa-miR-2117	CLIP-seq
MIRT1411428	hsa-miR-26a	CLIP-seq
MIRT1411429	hsa-miR-26b	CLIP-seq
MIRT1411430	hsa-miR-27a	CLIP-seq
MIRT1411431	hsa-miR-27b	CLIP-seq
MIRT1411432	hsa-miR-299-3p	CLIP-seq
MIRT2123524	hsa-miR-3064-3p	CLIP-seq
MIRT1411438	hsa-miR-3074-3p	CLIP-seq
MIRT1411440	hsa-miR-3120-3p	CLIP-seq
MIRT2123525	hsa-miR-3127-5p	CLIP-seq
MIRT2123526	hsa-miR-3133	CLIP-seq
MIRT1411443	hsa-miR-3148	CLIP-seq
MIRT2123527	hsa-miR-3156-3p	CLIP-seq
MIRT2123528	hsa-miR-3168	CLIP-seq
MIRT2123529	hsa-miR-3175	CLIP-seq
MIRT2123530	hsa-miR-3184	CLIP-seq
MIRT1411446	hsa-miR-329	CLIP-seq
MIRT2123531	hsa-miR-330-3p	CLIP-seq
MIRT2123532	hsa-miR-33a	CLIP-seq
MIRT2123533	hsa-miR-33b	CLIP-seq
MIRT2123534	hsa-miR-342-3p	CLIP-seq
MIRT2123535	hsa-miR-3614-3p	CLIP-seq
MIRT2123536	hsa-miR-3622a-3p	CLIP-seq
MIRT2123537	hsa-miR-3622b-3p	CLIP-seq
MIRT1411453	hsa-miR-362-3p	CLIP-seq
MIRT1411455	hsa-miR-3653	CLIP-seq
MIRT1411456	hsa-miR-3658	CLIP-seq
MIRT2123538	hsa-miR-3670	CLIP-seq
MIRT2123539	hsa-miR-3671	CLIP-seq
MIRT2123540	hsa-miR-3672	CLIP-seq
MIRT2123541	hsa-miR-3918	CLIP-seq
MIRT1411463	hsa-miR-3925-5p	CLIP-seq
MIRT1411464	hsa-miR-3936	CLIP-seq
MIRT1411465	hsa-miR-3977	CLIP-seq
MIRT2123542	hsa-miR-423-5p	CLIP-seq
MIRT1411466	hsa-miR-4262	CLIP-seq
MIRT2123543	hsa-miR-4264	CLIP-seq
MIRT2123544	hsa-miR-4273	CLIP-seq
MIRT1411468	hsa-miR-4299	CLIP-seq
MIRT1411469	hsa-miR-4310	CLIP-seq
MIRT2123545	hsa-miR-4317	CLIP-seq
MIRT1411471	hsa-miR-4418	CLIP-seq
MIRT2123546	hsa-miR-4428	CLIP-seq
MIRT2123547	hsa-miR-4446-3p	CLIP-seq
MIRT1411477	hsa-miR-4465	CLIP-seq
MIRT1411479	hsa-miR-4477b	CLIP-seq
MIRT2123548	hsa-miR-455-3p	CLIP-seq
MIRT1411485	hsa-miR-4668-3p	CLIP-seq
MIRT1411488	hsa-miR-4680-5p	CLIP-seq
MIRT2123549	hsa-miR-4690-3p	CLIP-seq
MIRT2123550	hsa-miR-4695-3p	CLIP-seq
MIRT2123551	hsa-miR-4703-3p	CLIP-seq
MIRT2123552	hsa-miR-4715-3p	CLIP-seq
MIRT2123553	hsa-miR-4716-5p	CLIP-seq
MIRT2123554	hsa-miR-4742-5p	CLIP-seq
MIRT1411503	hsa-miR-509-3-5p	CLIP-seq
MIRT1411505	hsa-miR-509-5p	CLIP-seq
MIRT2123555	hsa-miR-518a-5p	CLIP-seq
MIRT2123556	hsa-miR-527	CLIP-seq
MIRT1411513	hsa-miR-549	CLIP-seq
MIRT2123557	hsa-miR-576-5p	CLIP-seq
MIRT1411515	hsa-miR-587	CLIP-seq
MIRT2123558	hsa-miR-607	CLIP-seq
MIRT1411516	hsa-miR-642b	CLIP-seq
MIRT1411517	hsa-miR-802	CLIP-seq
MIRT1411406	hsa-miR-103a	CLIP-seq
MIRT1411407	hsa-miR-103b	CLIP-seq
MIRT1411409	hsa-miR-107	CLIP-seq
MIRT1411410	hsa-miR-1179	CLIP-seq
MIRT1411411	hsa-miR-1184	CLIP-seq
MIRT1411412	hsa-miR-1197	CLIP-seq
MIRT2345599	hsa-miR-1248	CLIP-seq
MIRT2345600	hsa-miR-1270	CLIP-seq
MIRT2345601	hsa-miR-1279	CLIP-seq
MIRT2345602	hsa-miR-1305	CLIP-seq
MIRT2345603	hsa-miR-1324	CLIP-seq
MIRT2345604	hsa-miR-137	CLIP-seq
MIRT2345605	hsa-miR-140-3p	CLIP-seq
MIRT2345606	hsa-miR-141	CLIP-seq
MIRT2345607	hsa-miR-1468	CLIP-seq
MIRT1411418	hsa-miR-181a	CLIP-seq
MIRT1411419	hsa-miR-181b	CLIP-seq
MIRT1411420	hsa-miR-181c	CLIP-seq
MIRT1411421	hsa-miR-181d	CLIP-seq
MIRT2123518	hsa-miR-186	CLIP-seq
MIRT2123521	hsa-miR-1910	CLIP-seq
MIRT1411423	hsa-miR-194	CLIP-seq
MIRT2345608	hsa-miR-200a	CLIP-seq
MIRT2345609	hsa-miR-200b	CLIP-seq
MIRT2345610	hsa-miR-200c	CLIP-seq
MIRT2345611	hsa-miR-2052	CLIP-seq
MIRT2123523	hsa-miR-2117	CLIP-seq
MIRT2345612	hsa-miR-23a	CLIP-seq
MIRT2345613	hsa-miR-23b	CLIP-seq
MIRT2345614	hsa-miR-23c	CLIP-seq
MIRT1411430	hsa-miR-27a	CLIP-seq
MIRT1411431	hsa-miR-27b	CLIP-seq
MIRT2345615	hsa-miR-2964a-5p	CLIP-seq
MIRT1411432	hsa-miR-299-3p	CLIP-seq
MIRT1411433	hsa-miR-302a	CLIP-seq
MIRT1411434	hsa-miR-302b	CLIP-seq
MIRT1411435	hsa-miR-302c	CLIP-seq
MIRT1411436	hsa-miR-302d	CLIP-seq
MIRT1411437	hsa-miR-302e	CLIP-seq
MIRT2123524	hsa-miR-3064-3p	CLIP-seq
MIRT1411438	hsa-miR-3074-3p	CLIP-seq
MIRT1411439	hsa-miR-3115	CLIP-seq
MIRT1411440	hsa-miR-3120-3p	CLIP-seq
MIRT2345616	hsa-miR-3121-5p	CLIP-seq
MIRT1411442	hsa-miR-3132	CLIP-seq
MIRT2123526	hsa-miR-3133	CLIP-seq
MIRT2345617	hsa-miR-3140-3p	CLIP-seq
MIRT2345618	hsa-miR-3145-5p	CLIP-seq
MIRT1411445	hsa-miR-3163	CLIP-seq
MIRT2345619	hsa-miR-323-3p	CLIP-seq
MIRT1411446	hsa-miR-329	CLIP-seq
MIRT1411449	hsa-miR-340	CLIP-seq
MIRT2123534	hsa-miR-342-3p	CLIP-seq
MIRT2345620	hsa-miR-361-3p	CLIP-seq
MIRT2123535	hsa-miR-3614-3p	CLIP-seq
MIRT1411451	hsa-miR-3614-5p	CLIP-seq
MIRT1411452	hsa-miR-3616-5p	CLIP-seq
MIRT2123536	hsa-miR-3622a-3p	CLIP-seq
MIRT2123537	hsa-miR-3622b-3p	CLIP-seq
MIRT1411453	hsa-miR-362-3p	CLIP-seq
MIRT2345621	hsa-miR-3646	CLIP-seq
MIRT1411454	hsa-miR-3647-5p	CLIP-seq
MIRT1411455	hsa-miR-3653	CLIP-seq
MIRT1411456	hsa-miR-3658	CLIP-seq
MIRT2123538	hsa-miR-3670	CLIP-seq
MIRT2123539	hsa-miR-3671	CLIP-seq
MIRT2123540	hsa-miR-3672	CLIP-seq
MIRT2345622	hsa-miR-3680	CLIP-seq
MIRT2345623	hsa-miR-3691-5p	CLIP-seq
MIRT1411458	hsa-miR-372	CLIP-seq
MIRT1411459	hsa-miR-373	CLIP-seq
MIRT1411460	hsa-miR-376a	CLIP-seq
MIRT1411461	hsa-miR-376b	CLIP-seq
MIRT2345624	hsa-miR-3910	CLIP-seq
MIRT1411463	hsa-miR-3925-5p	CLIP-seq
MIRT1411464	hsa-miR-3936	CLIP-seq
MIRT1411466	hsa-miR-4262	CLIP-seq
MIRT2123543	hsa-miR-4264	CLIP-seq
MIRT2345625	hsa-miR-4272	CLIP-seq
MIRT2123544	hsa-miR-4273	CLIP-seq
MIRT2345626	hsa-miR-4277	CLIP-seq
MIRT2345627	hsa-miR-429	CLIP-seq
MIRT1411468	hsa-miR-4299	CLIP-seq
MIRT1411469	hsa-miR-4310	CLIP-seq
MIRT2123545	hsa-miR-4317	CLIP-seq
MIRT1411471	hsa-miR-4418	CLIP-seq
MIRT1411472	hsa-miR-4422	CLIP-seq
MIRT2345628	hsa-miR-4427	CLIP-seq
MIRT2123546	hsa-miR-4428	CLIP-seq
MIRT1411473	hsa-miR-4436a	CLIP-seq
MIRT2345629	hsa-miR-4457	CLIP-seq
MIRT2345630	hsa-miR-4491	CLIP-seq
MIRT1411481	hsa-miR-4493	CLIP-seq
MIRT2345631	hsa-miR-4511	CLIP-seq
MIRT2123548	hsa-miR-455-3p	CLIP-seq
MIRT2345632	hsa-miR-4657	CLIP-seq
MIRT1411488	hsa-miR-4680-5p	CLIP-seq
MIRT2345633	hsa-miR-4683	CLIP-seq
MIRT1411489	hsa-miR-4685-5p	CLIP-seq
MIRT2123549	hsa-miR-4690-3p	CLIP-seq
MIRT2123550	hsa-miR-4695-3p	CLIP-seq
MIRT1411491	hsa-miR-4700-3p	CLIP-seq
MIRT2123552	hsa-miR-4715-3p	CLIP-seq
MIRT2123553	hsa-miR-4716-5p	CLIP-seq
MIRT2345634	hsa-miR-4724-5p	CLIP-seq
MIRT2345635	hsa-miR-4731-3p	CLIP-seq
MIRT2123554	hsa-miR-4742-5p	CLIP-seq
MIRT2345636	hsa-miR-4752	CLIP-seq
MIRT2345637	hsa-miR-4764-5p	CLIP-seq
MIRT1411497	hsa-miR-4795-5p	CLIP-seq
MIRT2345638	hsa-miR-4801	CLIP-seq
MIRT2345639	hsa-miR-508-5p	CLIP-seq
MIRT1411503	hsa-miR-509-3-5p	CLIP-seq
MIRT1411505	hsa-miR-509-5p	CLIP-seq
MIRT1411506	hsa-miR-520a-3p	CLIP-seq
MIRT1411507	hsa-miR-520b	CLIP-seq
MIRT1411508	hsa-miR-520c-3p	CLIP-seq
MIRT1411509	hsa-miR-520d-3p	CLIP-seq
MIRT1411510	hsa-miR-520e	CLIP-seq
MIRT1411511	hsa-miR-520f	CLIP-seq
MIRT2345640	hsa-miR-543	CLIP-seq
MIRT1411512	hsa-miR-545	CLIP-seq
MIRT2345641	hsa-miR-548ae	CLIP-seq
MIRT2345642	hsa-miR-548aj	CLIP-seq
MIRT2345643	hsa-miR-548am	CLIP-seq
MIRT2345644	hsa-miR-548b-3p	CLIP-seq
MIRT2345645	hsa-miR-548x	CLIP-seq
MIRT1411513	hsa-miR-549	CLIP-seq
MIRT1411514	hsa-miR-573	CLIP-seq
MIRT1411515	hsa-miR-587	CLIP-seq
MIRT2345646	hsa-miR-595	CLIP-seq
MIRT2123558	hsa-miR-607	CLIP-seq
MIRT2345647	hsa-miR-617	CLIP-seq
MIRT2345648	hsa-miR-620	CLIP-seq
MIRT2345649	hsa-miR-624	CLIP-seq
MIRT2345650	hsa-miR-630	CLIP-seq
MIRT1411517	hsa-miR-802	CLIP-seq
MIRT1411410	hsa-miR-1179	CLIP-seq
MIRT2123514	hsa-miR-1224-3p	CLIP-seq
MIRT1411440	hsa-miR-3120-3p	CLIP-seq
MIRT1411446	hsa-miR-329	CLIP-seq
MIRT1411453	hsa-miR-362-3p	CLIP-seq
MIRT1411464	hsa-miR-3936	CLIP-seq
MIRT1411469	hsa-miR-4310	CLIP-seq
MIRT2123514	hsa-miR-1224-3p	CLIP-seq
MIRT2123515	hsa-miR-1260	CLIP-seq
MIRT2123517	hsa-miR-1280	CLIP-seq
MIRT2123519	hsa-miR-188-3p	CLIP-seq
MIRT2123527	hsa-miR-3156-3p	CLIP-seq
MIRT2461138	hsa-miR-3647-3p	CLIP-seq
MIRT2461139	hsa-miR-3924	CLIP-seq
MIRT2123514	hsa-miR-1224-3p	CLIP-seq
MIRT2123515	hsa-miR-1260	CLIP-seq
MIRT2123517	hsa-miR-1280	CLIP-seq
MIRT2123519	hsa-miR-188-3p	CLIP-seq
MIRT2123527	hsa-miR-3156-3p	CLIP-seq
MIRT1411408	hsa-miR-105	CLIP-seq
MIRT1411410	hsa-miR-1179	CLIP-seq
MIRT2123514	hsa-miR-1224-3p	CLIP-seq
MIRT2638530	hsa-miR-1246	CLIP-seq
MIRT2123515	hsa-miR-1260	CLIP-seq
MIRT2123517	hsa-miR-1280	CLIP-seq
MIRT2638531	hsa-miR-1290	CLIP-seq
MIRT2345602	hsa-miR-1305	CLIP-seq
MIRT2638532	hsa-miR-1323	CLIP-seq
MIRT2345603	hsa-miR-1324	CLIP-seq
MIRT2345604	hsa-miR-137	CLIP-seq
MIRT2638533	hsa-miR-142-3p	CLIP-seq
MIRT2345607	hsa-miR-1468	CLIP-seq
MIRT1411418	hsa-miR-181a	CLIP-seq
MIRT1411419	hsa-miR-181b	CLIP-seq
MIRT1411420	hsa-miR-181c	CLIP-seq
MIRT1411421	hsa-miR-181d	CLIP-seq
MIRT2123518	hsa-miR-186	CLIP-seq
MIRT2123519	hsa-miR-188-3p	CLIP-seq
MIRT1411423	hsa-miR-194	CLIP-seq
MIRT1411424	hsa-miR-1972	CLIP-seq
MIRT2345611	hsa-miR-2052	CLIP-seq
MIRT1411430	hsa-miR-27a	CLIP-seq
MIRT1411431	hsa-miR-27b	CLIP-seq
MIRT1411432	hsa-miR-299-3p	CLIP-seq
MIRT2638534	hsa-miR-299-5p	CLIP-seq
MIRT2123524	hsa-miR-3064-3p	CLIP-seq
MIRT1411438	hsa-miR-3074-3p	CLIP-seq
MIRT1411440	hsa-miR-3120-3p	CLIP-seq
MIRT1411441	hsa-miR-3121-3p	CLIP-seq
MIRT2638535	hsa-miR-3130-3p	CLIP-seq
MIRT2123526	hsa-miR-3133	CLIP-seq
MIRT2345617	hsa-miR-3140-3p	CLIP-seq
MIRT1411443	hsa-miR-3148	CLIP-seq
MIRT2638536	hsa-miR-3154	CLIP-seq
MIRT2123527	hsa-miR-3156-3p	CLIP-seq
MIRT1411445	hsa-miR-3163	CLIP-seq
MIRT2638537	hsa-miR-3167	CLIP-seq
MIRT2123528	hsa-miR-3168	CLIP-seq
MIRT2638538	hsa-miR-3170	CLIP-seq
MIRT2638539	hsa-miR-320a	CLIP-seq
MIRT2638540	hsa-miR-320b	CLIP-seq
MIRT2638541	hsa-miR-320c	CLIP-seq
MIRT2638542	hsa-miR-320d	CLIP-seq
MIRT1411446	hsa-miR-329	CLIP-seq
MIRT1411447	hsa-miR-331-3p	CLIP-seq
MIRT1411449	hsa-miR-340	CLIP-seq
MIRT2123534	hsa-miR-342-3p	CLIP-seq
MIRT2123535	hsa-miR-3614-3p	CLIP-seq
MIRT1411451	hsa-miR-3614-5p	CLIP-seq
MIRT1411453	hsa-miR-362-3p	CLIP-seq
MIRT2123539	hsa-miR-3671	CLIP-seq
MIRT2345622	hsa-miR-3680	CLIP-seq
MIRT2638543	hsa-miR-3691-3p	CLIP-seq
MIRT1411462	hsa-miR-378g	CLIP-seq
MIRT1411463	hsa-miR-3925-5p	CLIP-seq
MIRT1411464	hsa-miR-3936	CLIP-seq
MIRT2638544	hsa-miR-3941	CLIP-seq
MIRT1411466	hsa-miR-4262	CLIP-seq
MIRT2638545	hsa-miR-4269	CLIP-seq
MIRT1411467	hsa-miR-4292	CLIP-seq
MIRT1411469	hsa-miR-4310	CLIP-seq
MIRT1411471	hsa-miR-4418	CLIP-seq
MIRT2123546	hsa-miR-4428	CLIP-seq
MIRT2638546	hsa-miR-4429	CLIP-seq
MIRT1411474	hsa-miR-4437	CLIP-seq
MIRT1411475	hsa-miR-4448	CLIP-seq
MIRT2345629	hsa-miR-4457	CLIP-seq
MIRT2638547	hsa-miR-4466	CLIP-seq
MIRT2638548	hsa-miR-4470	CLIP-seq
MIRT1411479	hsa-miR-4477b	CLIP-seq
MIRT1411480	hsa-miR-4480	CLIP-seq
MIRT1411481	hsa-miR-4493	CLIP-seq
MIRT1411482	hsa-miR-4495	CLIP-seq
MIRT2345631	hsa-miR-4511	CLIP-seq
MIRT2638549	hsa-miR-4514	CLIP-seq
MIRT1411483	hsa-miR-4635	CLIP-seq
MIRT2638550	hsa-miR-4650-5p	CLIP-seq
MIRT2638551	hsa-miR-466	CLIP-seq
MIRT2638552	hsa-miR-4661-5p	CLIP-seq
MIRT1411485	hsa-miR-4668-3p	CLIP-seq
MIRT1411486	hsa-miR-4672	CLIP-seq
MIRT1411487	hsa-miR-4674	CLIP-seq
MIRT1411489	hsa-miR-4685-5p	CLIP-seq
MIRT2638553	hsa-miR-4692	CLIP-seq
MIRT2123550	hsa-miR-4695-3p	CLIP-seq
MIRT1411491	hsa-miR-4700-3p	CLIP-seq
MIRT2123551	hsa-miR-4703-3p	CLIP-seq
MIRT2638554	hsa-miR-4714-3p	CLIP-seq
MIRT2345635	hsa-miR-4731-3p	CLIP-seq
MIRT2123554	hsa-miR-4742-5p	CLIP-seq
MIRT2638555	hsa-miR-4757-5p	CLIP-seq
MIRT1411494	hsa-miR-4768-3p	CLIP-seq
MIRT1411496	hsa-miR-4773	CLIP-seq
MIRT2638556	hsa-miR-4793-3p	CLIP-seq
MIRT2345638	hsa-miR-4801	CLIP-seq
MIRT1411498	hsa-miR-491-3p	CLIP-seq
MIRT2638557	hsa-miR-495	CLIP-seq
MIRT1411499	hsa-miR-499-3p	CLIP-seq
MIRT1411500	hsa-miR-499a-3p	CLIP-seq
MIRT1411501	hsa-miR-501-3p	CLIP-seq
MIRT1411502	hsa-miR-502-3p	CLIP-seq
MIRT1411503	hsa-miR-509-3-5p	CLIP-seq
MIRT1411504	hsa-miR-5095	CLIP-seq
MIRT1411505	hsa-miR-509-5p	CLIP-seq
MIRT2123555	hsa-miR-518a-5p	CLIP-seq
MIRT2123556	hsa-miR-527	CLIP-seq
MIRT2638558	hsa-miR-541	CLIP-seq
MIRT2345641	hsa-miR-548ae	CLIP-seq
MIRT2345642	hsa-miR-548aj	CLIP-seq
MIRT2345643	hsa-miR-548am	CLIP-seq
MIRT2345644	hsa-miR-548b-3p	CLIP-seq
MIRT2638559	hsa-miR-548o	CLIP-seq
MIRT2638560	hsa-miR-548t	CLIP-seq
MIRT2345645	hsa-miR-548x	CLIP-seq
MIRT2123557	hsa-miR-576-5p	CLIP-seq
MIRT1411515	hsa-miR-587	CLIP-seq
MIRT2638561	hsa-miR-593	CLIP-seq
MIRT2123558	hsa-miR-607	CLIP-seq
MIRT2345649	hsa-miR-624	CLIP-seq
MIRT1411516	hsa-miR-642b	CLIP-seq
MIRT2638562	hsa-miR-648	CLIP-seq
MIRT2638563	hsa-miR-654-5p	CLIP-seq
MIRT2638564	hsa-miR-675	CLIP-seq
MIRT2638565	hsa-miR-720	CLIP-seq
MIRT2638566	hsa-miR-767-5p	CLIP-seq
MIRT1411517	hsa-miR-802	CLIP-seq
MIRT2638567	hsa-miR-876-5p	CLIP-seq
MIRT1411518	hsa-miR-885-5p	CLIP-seq
MIRT1411408	hsa-miR-105	CLIP-seq
MIRT1411410	hsa-miR-1179	CLIP-seq
MIRT2123514	hsa-miR-1224-3p	CLIP-seq
MIRT2123515	hsa-miR-1260	CLIP-seq
MIRT2123517	hsa-miR-1280	CLIP-seq
MIRT2345602	hsa-miR-1305	CLIP-seq
MIRT2638532	hsa-miR-1323	CLIP-seq
MIRT2638533	hsa-miR-142-3p	CLIP-seq
MIRT2345607	hsa-miR-1468	CLIP-seq
MIRT1411418	hsa-miR-181a	CLIP-seq
MIRT1411419	hsa-miR-181b	CLIP-seq
MIRT1411420	hsa-miR-181c	CLIP-seq
MIRT1411421	hsa-miR-181d	CLIP-seq
MIRT2123518	hsa-miR-186	CLIP-seq
MIRT2123519	hsa-miR-188-3p	CLIP-seq
MIRT1411423	hsa-miR-194	CLIP-seq
MIRT1411424	hsa-miR-1972	CLIP-seq
MIRT2345611	hsa-miR-2052	CLIP-seq
MIRT2123523	hsa-miR-2117	CLIP-seq
MIRT2345612	hsa-miR-23a	CLIP-seq
MIRT2345613	hsa-miR-23b	CLIP-seq
MIRT2345614	hsa-miR-23c	CLIP-seq
MIRT1411430	hsa-miR-27a	CLIP-seq
MIRT1411431	hsa-miR-27b	CLIP-seq
MIRT1411432	hsa-miR-299-3p	CLIP-seq
MIRT2638534	hsa-miR-299-5p	CLIP-seq
MIRT2123524	hsa-miR-3064-3p	CLIP-seq
MIRT1411440	hsa-miR-3120-3p	CLIP-seq
MIRT1411441	hsa-miR-3121-3p	CLIP-seq
MIRT2638535	hsa-miR-3130-3p	CLIP-seq
MIRT2123526	hsa-miR-3133	CLIP-seq
MIRT1411443	hsa-miR-3148	CLIP-seq
MIRT2638536	hsa-miR-3154	CLIP-seq
MIRT2123527	hsa-miR-3156-3p	CLIP-seq
MIRT1411445	hsa-miR-3163	CLIP-seq
MIRT2123528	hsa-miR-3168	CLIP-seq
MIRT2638538	hsa-miR-3170	CLIP-seq
MIRT1411446	hsa-miR-329	CLIP-seq
MIRT1411447	hsa-miR-331-3p	CLIP-seq
MIRT1411449	hsa-miR-340	CLIP-seq
MIRT2123534	hsa-miR-342-3p	CLIP-seq
MIRT2123535	hsa-miR-3614-3p	CLIP-seq
MIRT1411453	hsa-miR-362-3p	CLIP-seq
MIRT2123539	hsa-miR-3671	CLIP-seq
MIRT2638543	hsa-miR-3691-3p	CLIP-seq
MIRT1411462	hsa-miR-378g	CLIP-seq
MIRT1411464	hsa-miR-3936	CLIP-seq
MIRT2638544	hsa-miR-3941	CLIP-seq
MIRT1411466	hsa-miR-4262	CLIP-seq
MIRT2638545	hsa-miR-4269	CLIP-seq
MIRT2123544	hsa-miR-4273	CLIP-seq
MIRT2345626	hsa-miR-4277	CLIP-seq
MIRT1411467	hsa-miR-4292	CLIP-seq
MIRT1411469	hsa-miR-4310	CLIP-seq
MIRT2123545	hsa-miR-4317	CLIP-seq
MIRT2123546	hsa-miR-4428	CLIP-seq
MIRT1411474	hsa-miR-4437	CLIP-seq
MIRT1411475	hsa-miR-4448	CLIP-seq
MIRT2345629	hsa-miR-4457	CLIP-seq
MIRT2638548	hsa-miR-4470	CLIP-seq
MIRT1411479	hsa-miR-4477b	CLIP-seq
MIRT1411480	hsa-miR-4480	CLIP-seq
MIRT1411481	hsa-miR-4493	CLIP-seq
MIRT1411482	hsa-miR-4495	CLIP-seq
MIRT2345631	hsa-miR-4511	CLIP-seq
MIRT2638549	hsa-miR-4514	CLIP-seq
MIRT1411483	hsa-miR-4635	CLIP-seq
MIRT2638551	hsa-miR-466	CLIP-seq
MIRT2638552	hsa-miR-4661-5p	CLIP-seq
MIRT1411485	hsa-miR-4668-3p	CLIP-seq
MIRT1411486	hsa-miR-4672	CLIP-seq
MIRT1411487	hsa-miR-4674	CLIP-seq
MIRT1411489	hsa-miR-4685-5p	CLIP-seq
MIRT2123549	hsa-miR-4690-3p	CLIP-seq
MIRT2638553	hsa-miR-4692	CLIP-seq
MIRT2123550	hsa-miR-4695-3p	CLIP-seq
MIRT1411491	hsa-miR-4700-3p	CLIP-seq
MIRT2123551	hsa-miR-4703-3p	CLIP-seq
MIRT2638554	hsa-miR-4714-3p	CLIP-seq
MIRT2123552	hsa-miR-4715-3p	CLIP-seq
MIRT2123553	hsa-miR-4716-5p	CLIP-seq
MIRT2345635	hsa-miR-4731-3p	CLIP-seq
MIRT2123554	hsa-miR-4742-5p	CLIP-seq
MIRT1411494	hsa-miR-4768-3p	CLIP-seq
MIRT1411496	hsa-miR-4773	CLIP-seq
MIRT2638556	hsa-miR-4793-3p	CLIP-seq
MIRT2345638	hsa-miR-4801	CLIP-seq
MIRT1411498	hsa-miR-491-3p	CLIP-seq
MIRT2638557	hsa-miR-495	CLIP-seq
MIRT1411499	hsa-miR-499-3p	CLIP-seq
MIRT1411500	hsa-miR-499a-3p	CLIP-seq
MIRT1411501	hsa-miR-501-3p	CLIP-seq
MIRT1411502	hsa-miR-502-3p	CLIP-seq
MIRT1411504	hsa-miR-5095	CLIP-seq
MIRT2123555	hsa-miR-518a-5p	CLIP-seq
MIRT2123556	hsa-miR-527	CLIP-seq
MIRT2638558	hsa-miR-541	CLIP-seq
MIRT2345641	hsa-miR-548ae	CLIP-seq
MIRT2345642	hsa-miR-548aj	CLIP-seq
MIRT2345643	hsa-miR-548am	CLIP-seq
MIRT2345644	hsa-miR-548b-3p	CLIP-seq
MIRT2638559	hsa-miR-548o	CLIP-seq
MIRT2345645	hsa-miR-548x	CLIP-seq
MIRT2123557	hsa-miR-576-5p	CLIP-seq
MIRT2638561	hsa-miR-593	CLIP-seq
MIRT2123558	hsa-miR-607	CLIP-seq
MIRT2345649	hsa-miR-624	CLIP-seq
MIRT1411516	hsa-miR-642b	CLIP-seq
MIRT2638562	hsa-miR-648	CLIP-seq
MIRT2638563	hsa-miR-654-5p	CLIP-seq
MIRT2638565	hsa-miR-720	CLIP-seq
MIRT2638566	hsa-miR-767-5p	CLIP-seq
MIRT1411518	hsa-miR-885-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0001933	Process	Negative regulation of protein phosphorylation	IMP	18305152
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003677	Function	DNA binding	EXP	26735904
GO:0003677	Function	DNA binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IDA	7745706
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IDA	11285240
GO:0003723	Function	RNA binding	IEA
GO:0003723	Function	RNA binding	IMP	25678563
GO:0003730	Function	MRNA 3'-UTR binding	IDA	17481916
GO:0005515	Function	Protein binding	IPI	15231747, 16169070, 18377426, 20740007, 21903422, 23541532, 24169621, 24690380, 25678563, 26571498, 26752685, 27615052, 28514442, 29109149, 29153328, 29725819, 32814053, 35271311, 37788672
GO:0005634	Component	Nucleus	IDA	11285240, 17481916, 25678563
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005726	Component	Perichromatin fibrils	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0006397	Process	MRNA processing	IEA
GO:0008289	Function	Lipid binding	EXP	26735904
GO:0008380	Process	RNA splicing	IDA	11285240
GO:0008380	Process	RNA splicing	IEA
GO:0008380	Process	RNA splicing	IEA
GO:0010467	Process	Gene expression	IEA
GO:0010468	Process	Regulation of gene expression	IBA
GO:0010494	Component	Cytoplasmic stress granule	IEA
GO:0010629	Process	Negative regulation of gene expression	IMP	18305152
GO:0016607	Component	Nuclear speck	IEA
GO:0031647	Process	Regulation of protein stability	IEA
GO:0031647	Process	Regulation of protein stability	IMP	27123980
GO:0032024	Process	Positive regulation of insulin secretion	IEA
GO:0034976	Process	Response to endoplasmic reticulum stress	IEA
GO:0035061	Component	Interchromatin granule	IEA
GO:0042307	Process	Positive regulation of protein import into nucleus	IEA
GO:0042752	Process	Regulation of circadian rhythm	IEA
GO:0042802	Function	Identical protein binding	IPI	19383787, 21666678, 22193716, 23384725, 26099433, 26735904, 29531287, 31235914
GO:0042981	Process	Regulation of apoptotic process	IMP	18305152
GO:0043922	Process	Host-mediated suppression of viral transcription	IDA	7745706
GO:0048511	Process	Rhythmic process	IEA
GO:0051726	Process	Regulation of cell cycle	IMP	18305152
GO:0061158	Process	3'-UTR-mediated mRNA destabilization	IDA	28335005
GO:0070935	Process	3'-UTR-mediated mRNA stabilization	IDA	17481916
GO:0071765	Process	Nuclear inner membrane organization	IMP	18305152
GO:0097157	Function	Pre-mRNA intronic binding	IEA
GO:0140693	Function	Molecular condensate scaffold activity	IDA	27545621, 28988034, 29511089
GO:1990000	Process	Amyloid fibril formation	IDA	26735904

Other IDs

• MIM: 605078
• HGNC: 11571
• e!Ensembl: ENSG00000120948

Protein

• UniProt ID: Q13148
• Protein name: TAR DNA-binding protein 43 (TDP-43)
• Protein function: RNA-binding protein that is involved in various steps of RNA biogenesis and processing (PubMed:23519609). Preferentially binds, via its two RNA recognition motifs RRM1 and RRM2, to GU-repeats on RNA molecules predominantly localized within long
• PDB: 1WF0, 2CQG, 2N2C, 2N3X, 2N4G, 2N4H, 2N4P, 4BS2, 4IUF, 4Y00, 4Y0F, 5MDI, 5MRG, 5W50, 5W52, 5W7V, 5WHN, 5WHP, 5WIA, 5WIQ, 5WKB, 5WKD, 5X4F, 6B1G, 6CF4, 6CFH, 6N37, 6N3A, 6N3B, 6N3C, 6T4B, 7KWZ, 7N9H, 7PY2, 7Q3U, 8A6I, 8CG3, 8CGG, 8CGH, 8QX9, 8QXA, 8QXB, 9FOF, 9FOR
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF18694	TDP43_N	4 → 77	Transactive response DNA-binding protein N-terminal domain	Domain
  PF00076	RRM_1	106 → 172	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
  PF00076	RRM_1	193 → 243	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed. In particular, expression is high in pancreas, placenta, lung, genital tract and spleen.
• Sequence:

  MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGI
  LHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDL
  KEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNS
  KQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIA
  QSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNPGGFGNQGGFGNSRGGGAGLG
  NNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQ
  REPNQAFGSGNNSYSGSNSGAAIGWGSASNAGSGSGFNGGFGSSMDSKSSGWGM

• Sequence length: 414

Pathways

KEGG:

mRNA surveillance pathway
Amyotrophic lateral sclerosis
Pathways of neurodegeneration - multiple diseases

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Amyotrophic lateral sclerosis type 10	Pathogenic; Likely pathogenic	rs766196255, rs80356730, rs80356727, rs4884357, rs80356717, rs80356733, rs80356731, rs80356726, rs1553159739, rs80356732, rs80356734, rs367543041, rs80356740, rs80356719, rs80356723, rs80356725, rs1643659556, rs1304706298, rs1557660662	RCV002664150 RCV000005539 RCV000005540 RCV000005543 RCV000005544 RCV000005545 RCV000005546 RCV000005547 RCV003226896 RCV000703167 RCV000020657 RCV000020663 RCV000995885 RCV000020672 RCV000020674 RCV000694078 RCV001095433 RCV001207766 RCV001208497	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Frontotemporal dementia	Likely pathogenic	rs1570725499	RCV000986235	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
FRONTOTEMPORAL DEMENTIA WITH TDP43 INCLUSIONS, TARDBP-RELATED	Pathogenic; Likely pathogenic	rs267607102, rs367543041	RCV000005549 RCV000106321	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
FRONTOTEMPORAL LOBAR DEGENERATION WITH TDP43 INCLUSIONS, TARDBP-RELATED	Pathogenic; Likely pathogenic	rs766196255, rs80356730, rs4884357, rs80356733, rs80356726, rs80356732, rs80356734, rs367543041, rs80356740, rs80356719, rs80356723, rs80356725, rs1304706298, rs1557660662	RCV002664150 RCV000693006 RCV001851670 RCV001851671 RCV001384596 RCV000703167 RCV001851975 RCV002513146 RCV001851976 RCV000529539 RCV003764615 RCV000694078 RCV001207766 RCV001208497	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Motor neuron disease	Pathogenic; Likely pathogenic	rs1131690782, rs80356719	RCV000492607 RCV000492328	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
TARDBP-related disorder	Likely pathogenic; Pathogenic	rs4884357, rs80356734, rs367543041, rs80356740, rs80356719, rs80356725	RCV004754243 RCV004754269 RCV003944833 RCV004754270 RCV004754271 RCV004754273	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMYOTROPHIC LATERAL SCLEROSIS	—	CTD, Disgenet, GWAS catalog, Orphanet CTD, Disgenet, GWAS catalog, Orphanet CTD, Disgenet, GWAS catalog, Orphanet CTD, Disgenet, GWAS catalog, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS 1	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS 10	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS 10 WITH OR WITHOUT FRONTOTEMPORAL DEMENTIA	—	HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis, Dominant	Likely benign; Uncertain significance; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEGENERATIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FRONTOTEMPORAL DEMENTIA WITH MOTOR NEURON DISEASE	—	Disgenet, GenCC, Orphanet Disgenet, GenCC, Orphanet Disgenet, GenCC, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MASP2 DEFICIENCY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOSITIS, INCLUSION BODY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinsonian disorder	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
AA amyloidosis	AA amyloidosis	BEFREE	25907990		★☆☆☆☆ Found in Text Mining only
Alexander Disease	Alexander Disease	BEFREE	24806671		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	23942216		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	GWASCAT_DG	28196072		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	20142524, 20197700, 20361198, 21031599, 21346515, 24240737, 24690380, 26224156, 26260327, 26507309, 27694152, 28167528, 28332094, 28630030, 29438978, 30367664, 30422173, 32301481, 32349792, 32408057, 32568358, 32735084, 32882370, 33771571, 33969528, 34035398, 34252884, 35258170, 36057624, 36120397, 36189598, 36633448, 37182869, 37525358, 38175301, 39302099	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	21968532		★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	26224156, 30010126, 30922385, 31056344, 31678156		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	23124365, 26979082, 27785573, 28395086, 30382507, 30464263		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	17023659, 17469116, 17481916, 17543992, 17614162, 17702495, 17764635, 17984323, 18068872, 18090423, 18305110, 18309045, 18372902, 18396105, 18438952, 18505686, 18545701, 18634762, 18684309, 18723384, 18759352, 18771956, 18779421, 18802454, 18929508, 18931000, 18989115, 19018245, 19104447, 19111550, 19112176, 19164285, 19223871, 19224587, 19236453, 19251627, 19271105, 19283396, 19285963, 19303844, 19333444, 19379745, 19379791, 19383787, 19449021, 19465477, 19496940, 19593125, 19609911, 19664364, 19737636, 19741216, 19760257, 19781077, 19798749, 19808791, 19815002, 19833869, 19840884, 19851068, 19864663, 19864664, 19910924, 19959528, 20008652, 20031275, 20047951, 20055380, 20082726, 20083106, 20111867, 20133711, 20202122, 20226177, 20234357, 20349096, 20361056, 20370663, 20372915, 20400460, 20406182, 20406184, 20406185, 20413882, 20472325, 20472655, 20551689, 20554523, 20555136, 20577002, 20598774, 20600671, 20601083, 20645878, 20655970, 20675015, 20697052, 20702714, 20728492, 20740007, 20806063, 20864052, 20877346, 20933032, 20942785, 20948999, 20951205, 20971753, 21086759, 21104415, 21115123, 21120508, 21123567, 21124004, 21145000, 21158017, 21173160, 21206091, 21220647, 21222600, 21280084, 21326809, 21339291, 21355045, 21376022, 21418058, 21421050, 21450909, 21452073, 21454603, 21454607, 21487023, 21541367, 21610160, 21644038, 21651514, 21666678, 21667065, 21673800, 21678031, 21706176, 21706386, 21725240, 21752789, 21777387, 21777389, 21777407, 21783422, 21787329, 21803454, 21809041, 21810174, 21811811, 21829392, 21834058, 21857683, 21863317, 21881207, 21933185, 21943958, 21944778, 21956718, 22028183, 22029574, 22051914, 22065782, 22072660, 22072931, 22084410, 22098653, 22105541, 22147697, 22156203, 22181065, 22232551, 22235134, 22252998, 22261247, 22292798, 22292843, 22340366, 22342159, 22361451, 22363618, 22366792, 22398199, 22406069, 22420316, 22424122, 22444279, 22451909, 22456481, 22473010, 22477152, 22493728, 22526021, 22539580, 22563080, 22571983, 22575358, 22578468, 22641816, 22645277, 22692064, 22697423, 22702520, 22705710, 22732773, 22751173, 22764223, 22792076, 22801503, 22827270, 22835604, 22848727, 22868089, 22873561, 22892647, 22898872, 22900096, 22941224, 22944662, 22957047, 22993125, 23001869, 23023293, 23041957, 23042786, 23062702, 23084342, 23104007, 23124365, 23138004, 23172908, 23231971, 23235148, 23255347, 23300771, 23317354, 23327806, 23345247, 23415570, 23424178, 23427147, 23457265, 23475610, 23559573, 23567652, 23575225, 23587065, 23644307, 23686809, 23689371, 23714777, 23727833, 23740936, 23742895, 23804749, 23827948, 23867462, 23881933, 23898972, 23900071, 23922830, 23954172, 24011641, 24019256, 24085347, 24105464, 24112438, 24132570, 24143176, 24154542, 24252274, 24256250, 24262168, 24312274, 24336168, 24355598, 24355761, 24378564, 24381309, 24462217, 24466128, 24477737, 24497641, 24507191, 24515116, 24591609, 24651281, 24686783, 24740308, 24750229, 24806671, 24836899, 24860144, 24920338, 24927705, 24931836, 24974230, 25086858, 25088712, 25111021, 25123918, 25213598, 25215604, 25239623, 25283820, 25354681, 25375143, 25410660, 25429138, 25432537, 25442115, 25457553, 25473830, 25503365, 25556531, 25613506, 25637145, 25652699, 25681989, 25701498, 25720411, 25788357, 25792239, 25792726, 25811799, 25819934, 25907990, 25943887, 25998392, 26002100, 26013250, 26047658, 26064939, 26067594, 26089325, 26108367, 26108573, 26130692, 26136049, 26174443, 26197969, 26233805, 26234214, 26250685, 26294190, 26298469, 26327808, 26334913, 26373655, 26385636, 26391765, 26410029, 26437864, 26444430, 26514432, 26515626, 26525917, 26551617, 26555887, 26598648, 26639158, 26672899, 26702100, 26735904, 26757674, 26900927, 26908597, 26915990, 26926802, 26936937, 27015757, 27016404, 27080313, 27101846, 27150074, 27151080, 27178390, 27193329, 27226551, 27236050, 27257061, 27288806, 27338628, 27338935, 27348499, 27378374, 27432186, 27445147, 27445339, 27466192, 27466204, 27496536, 27535427, 27545621, 27570180, 27590623, 27600654, 27604643, 27621269, 27634045, 27693252, 27838743, 27849576, 27906075, 27920024, 27928708, 27935101, 27940503, 27942908, 28000730, 28007900, 28040728, 28057298, 28062558, 28072389, 28100023, 28112502, 28122516, 28129109, 28148298, 28158562, 28163215, 28167528, 28167899, 28243725, 28265061, 28286471, 28301478, 28324764, 28330421, 28332094, 28334913, 28336525, 28357566, 28358904, 28380257, 28389532, 28405022, 28429524, 28444573, 28453527, 28456383, 28472174, 28476168, 28487370, 28497562, 28510254, 28510586, 28521037, 28531192, 28539470, 28549443, 28566288, 28599005, 28611593, 28620838, 28622300, 28637276, 28663553, 28686708, 28705014, 28710326, 28711596, 28724966, 28754988, 28762175, 28793209, 28794432, 28818672, 28832631, 28842427, 28847811, 28848086, 28852778, 28854702, 28859337, 28859339, 28860970, 28872135, 28906030, 28960544, 28969660, 28978466, 28980850, 28980860, 28988034, 29024655, 29035885, 29070802, 29078806, 29079747, 29097807, 29109084, 29115989, 29125873, 29128563, 29142232, 29153610, 29187283, 29191947, 29196813, 29233983, 29272468, 29279008, 29295857, 29299811, 29308690, 29311743, 29313467, 29358575, 29383655, 29395044, 29409023, 29421661, 29438978, 29449089, 29449800, 29458840, 29460270, 29472250, 29474575, 29477906, 29486049, 29513014, 29545601, 29562314, 29574689, 29577934, 29587294, 29599716, 29615863, 29621978, 29630712, 29630989, 29653597, 29662239, 29715546, 29725819, 29731706, 29742622, 29751083, 29751289, 29755516, 29760282, 29764981, 29778779, 29779213, 29787572, 29787578, 29790082, 29800782, 29801890, 29802307, 29804146, 29807145, 29859124, 29866003, 29878075, 29889265, 29901412, 29943193, 29944911, 29954341, 29982879, 29982983, 29987190, 30030424, 30030753, 30072868, 30099725, 30100264, 30120199, 30128653, 30157547, 30157956, 30193092, 30193933, 30237395, 30239641, 30290270, 30309612, 30315897, 30317421, 30326935, 30333186, 30353006, 30356856, 30357366, 30359484, 30368160, 30372676, 30373824, 30376609, 30377984, 30399416, 30401824, 30404641, 30425620, 30442180, 30450515, 30461104, 30461368, 30471417, 30486313, 30489059, 30508770, 30509290, 30511354, 30520038, 30520297, 30520513, 30541625, 30553531, 30578840, 30618614, 30625319, 30630951, 30643292, 30643298, 30659642, 30663610, 30667370, 30700593, 30728452, 30742062, 30742696, 30785719, 30810811, 30824544, 30826182, 30837838, 30853299, 30863908, 30909235, 30922385, 30938443, 30948513, 31005259, 31017923, 31018129, 31020724, 31031584, 31036551, 31042469, 31067307, 31068973, 31100073, 31124187, 31124595, 31132469, 31144027, 31152038, 31165305, 31176717, 31180318, 31213972, 31229690, 31235914, 31241884, 31242080, 31252669, 31259382, 31272829, 31287959, 31310801, 31316455, 31332509, 31345270, 31355778, 31357627, 31373095, 31382054, 31386770, 31390360, 31430111, 31445085, 31485326, 31495585, 31504678, 31515300, 31519910, 31529970, 31555895, 31568752, 31577344, 31595953, 31596526, 31605140, 31619481, 31626953, 31642482, 31661037, 31663379, 31690171, 31693373, 31702460, 31714900, 31726180, 31728929, 31736708, 31742901, 31766750, 31767634, 31773773, 31782904, 31787882, 31802540, 31820696		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	LHGDN	17023659, 17492294, 17569066, 18305110, 18309045, 18372902, 18438952, 18520774, 18656473, 18779421, 18802454, 18843496, 18923836, 18931000, 19191304		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	17898224, 17936612, 17984323, 18396105, 18505686, 18545701, 18703504, 18723384, 18779421, 18802454, 19111550, 19112176, 19139310, 19338576, 19383787, 19449021, 19741216, 20020773, 20031275, 20082726, 20142524, 20154440, 20423455, 20554523, 20577002, 20598774, 20697052, 20720006, 20855563, 20948999, 21031599, 21104415, 21131904, 21220647, 21280084, 21358640, 21452073, 21454603, 21541367, 21610160, 21666678, 21667065, 21803454, 21857683, 21943958, 22083254, 22121224, 22323604, 22366792, 22451909, 22473010, 22526021, 22563080, 22563406, 22735976, 22739338, 22752089, 22764223, 22892647, 22900096, 22993064, 22993125, 23022481, 23048034, 23078282, 23084342, 23092511, 23100398, 23124365, 23138004, 23231971, 23398327, 23401527, 23558684, 23575225, 23704877, 23755159, 23831027, 23840699, 23881933, 23942216, 24143176, 24252274, 24252504, 24424030, 24439481, 24462217, 24464995, 24497641, 24591609, 24651281, 24686783, 24690380, 25111021, 25122661, 25123918, 25375143, 25492614, 25503365, 25580746, 25630387, 25635624, 25637145, 25681989, 25742170, 25788357, 25943887, 26056265, 26099433, 26108573, 26260327, 26303227, 26327808, 26735904, 26883171, 26980269, 27257061, 27338935, 27432186, 27545621, 27604643, 27838743, 27849576, 28122516, 28158562, 28167528, 28282387, 28332094, 28367944, 28430856, 28510586, 28539470, 28566288, 28793209, 28794432, 28852778, 29191947, 29196813, 29243911, 29438978, 29562314, 29653597, 29742622, 29751289, 29779213, 29800782, 29912613, 30014505, 30030424, 30045958, 30120199, 30359484, 30368160, 30376609, 30461104, 30520513, 30572951, 30643292, 30643298, 30659642, 30700593, 30720798, 30824544, 30905713, 30909235, 30940688, 31017923, 31042469, 31067307, 31152038, 31196199, 31235914, 31382054, 31386770, 31439573, 31527135, 31529970, 31605140, 31693373, 31767634, 31932031, 32040555, 32132204, 32217641, 32330447, 32337711, 32616036, 32628315, 32633852, 32731393, 32778941, 32827688, 32872449, 32917270, 32989039, 32992901, 33003404, 33074248, 33137311, 33144500, 33151007, 33159016, 33172210, 33242422, 33284045, 33314436, 33479441, 33647321, 33692125, 33693641, 33709219, 33770234, 33771571, 33803845, 33888768, 33972534, 34068231, 34087986, 34131277, 34152475, 34274995, 34291734, 34380047, 34390468, 34544842, 34548609, 34758687, 34769284, 34835107, 34880495, 34953857, 35015250, 35045337, 35076694, 35197626, 35227277, 35231559, 35264561, 35409310, 35576218, 35641224, 35667216, 35714448, 35871544, 35932023, 35954242, 36233180, 36261296, 36291062, 36293534, 36309735, 36362259, 36499097, 36512061, 36527420, 36549973, 36552734, 36555863, 36563944, 36633448, 36674783, 36747013, 36827976, 36930291, 36930682, 36982587, 37046025, 37080969, 37147573, 37150879, 37184603, 37189452, 37208601, 37220877, 37313936, 37315423, 37339631, 37431963, 37466726, 37496071, 37527763, 37532939, 37540751, 37569549, 37608584, 37651231, 37691292, 37739033, 37914747, 37949836, 38002982, 38123999, 38139294, 38175301, 38277467, 39302099, 39336748, 39662462, 40010009, 40097075, 40243477, 40316175, 40454469	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	CTD_human_DG	18372902, 21167262, 22879928, 23104007, 24019256, 24252504		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	ORPHANET_DG	24085347		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic lateral sclerosis	Amyotrophic Lateral Sclerosis	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	34544842, 39241471	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic lateral sclerosis 1	Amyotrophic lateral sclerosis	Pubtator	18779421, 18802454, 19411082, 19450904, 19618195, 20031275, 20082726, 20154440, 20558945, 20577002, 20598774, 21667065, 22451909, 23006766, 23874513, 26704906, 27338935, 27757524, 28969660, 29621978, 29653597, 29881994, 29912613, 30643292, 30905713, 33313661, 33421065, 34131277, 34333853, 35015250, 35667216, 35932023, 37046025, 37189452, 38002982, 38079474	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	BEFREE	19450904, 19618195, 20472325, 20544928, 21667065, 21956716, 22398199, 22499346, 22575358, 23874513, 26630559, 29982983		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic lateral sclerosis 1	Amyotrophic lateral sclerosis	Pubtator	23678876	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis 10	Amyotrophic lateral sclerosis	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS 10 (disorder)	Amyotrophic lateral sclerosis	UNIPROT_DG	18288693, 18309045, 18372902, 18396105, 18438952, 19224587, 19350673, 19655382, 19695877, 20740007, 21220647, 21418058, 22456481		★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 10 (disorder)	Amyotrophic lateral sclerosis	CLINVAR_DG	18309045, 18372902, 18396105, 19224587, 19465477, 19760257, 20154440, 20600671, 20624952, 22539580, 23235148, 23401527, 23827948, 24143176, 24477737, 24507191, 25442115, 28430856, 28709720		★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 10 (disorder)	Amyotrophic lateral sclerosis	GENOMICS_ENGLAND_DG	18372902, 23881933		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis With Dementia	Amyotrophic Lateral Sclerosis With Dementia	CTD_human_DG	18372902, 21167262, 22879928, 23104007, 24019256, 24252504		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	BEFREE	17333220, 18372902, 18438952, 18779421, 18802454, 18989115, 19379745, 19411082, 19496940, 19618195, 19781077, 19833869, 20598774, 20933032, 21752789, 21956716, 21956718, 22366794, 23235148, 23327806, 23874513, 24154542, 24466128, 26096467, 26630559, 26908597, 27432186, 29272468, 29621978, 30905713, 31124595		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Guam Form	Amyotrophic lateral sclerosis	CTD_human_DG	18372902, 21167262, 22879928, 23104007, 24019256, 24252504		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	BEFREE	17333220, 17469116, 18304732, 18309045, 18545701, 18931000, 18989115, 19236453, 19379745, 19411082, 19695877, 19864663, 20372915, 20472655, 20675015, 20708823, 21418058, 22028183, 23006766, 24439481, 24785678, 26174443, 26515626, 26704906, 26936937, 26994698, 27757524, 28632899, 28906030, 29186496, 29630989, 29881994, 29938835, 30578840, 30618218, 31020724, 31504678, 31663379		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	31127776		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	31127776		★☆☆☆☆ Found in Text Mining only
Apraxias	Apraxia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	21172843, 21172844, 26791154, 29305438, 30422173, 30511086, 32500143, 40174910	Associate	★☆☆☆☆ Found in Text Mining only
Autistic behavior	Autism	BEFREE	29715444		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	23543794, 30575981		★☆☆☆☆ Found in Text Mining only
Basal Ganglia Diseases	Basal ganglia disease	Pubtator	21220647, 21803454, 23546887, 35045337	Associate	★☆☆☆☆ Found in Text Mining only
Behavioral variant of frontotemporal dementia	Behavioral Variant Of Frontotemporal Dementia	BEFREE	23231971, 27288806, 29584904, 29751289		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	39600279	Inhibit	★☆☆☆☆ Found in Text Mining only
Blepharoptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	24659241, 31056344		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	21294910, 35697880, 36057624, 37966908	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26902425		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35504883	Associate	★☆☆☆☆ Found in Text Mining only
Brown-Vialetto-Van Laere Syndrome 1	Brown-Vialetto-Van Laere Syndrome	BEFREE	22766032		★☆☆☆☆ Found in Text Mining only
Bulbar palsy	Bulbar palsy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Calcium Metabolism Disorders	Calcium metabolism disorders	Pubtator	32330447	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	30087231, 38281298	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	35811810	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23874513, 34133325, 35963893	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	19112176	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	26265046, 28952053		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29916037		★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	22752089	Associate	★☆☆☆☆ Found in Text Mining only
Cerebellar Diseases	Cerebellar diseases	Pubtator	22752089	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	BEFREE	28205009, 30092839		★☆☆☆☆ Found in Text Mining only
CEREBRAL AMYLOID ANGIOPATHY, ITM2B-RELATED, 1	Cerebral Amyloid Angiopathy	BEFREE	19283396		★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	24659241, 29305438, 31056344, 31520153		★☆☆☆☆ Found in Text Mining only
Cerebral cortical atrophy	Cerebral cortical atrophy	BEFREE	29305438, 31520153		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	30922392		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30413172		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	26159191, 29916037		★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth Disease	Charcot-Marie-Tooth Disease	BEFREE	29029362		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	18779421, 23546887, 25012223, 27694152, 28630030, 29191947, 30422173, 31386770, 33576076, 33579840, 35697880, 37039659, 38062485, 38175301	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	23954172, 29755516, 31386770		★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	20697052, 26224156	Associate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	24690380	Stimulate	★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	22898872, 26108573		★☆☆☆☆ Found in Text Mining only
Corticobasal degeneration	Corticobasal Degeneration	BEFREE	21908872, 24252525, 24861427, 28205009, 31033382		★☆☆☆☆ Found in Text Mining only
Corticobasal Degeneration	Corticobasal degeneration	Pubtator	21943958, 23371366, 29926172, 31950334	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	20855563	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	27890430, 30734541, 30784197		★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	LHGDN	17360763, 18087705, 18723524, 19139911		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	17469116, 18505686, 19139911, 19283396, 19851068, 20697052, 21471218, 22848727, 23084342, 23172908, 24927705, 25215604, 26159191, 27015757, 28176659, 29053785, 29511089, 29556029, 29614661, 29944741, 30010126, 30396335, 30753613, 31034749, 31376286, 31562527, 31568752, 31678156		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	18505686, 21346515, 21471218, 21667065, 22550220, 23084342, 29511089, 33061333, 33579840, 35120450, 35366087	Associate	★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	32217641	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dermatopathia pigmentosa reticularis	Dermatopathia Pigmentosa Reticularis	BEFREE	25185840		★☆☆☆☆ Found in Text Mining only
Deuteranomaly	Deuteranomaly	BEFREE	29926172, 31033382		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28582864		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	30320895		★☆☆☆☆ Found in Text Mining only
Diffuse Cerebral Sclerosis of Schilder	Schilder disease	Pubtator	19299900	Stimulate	★☆☆☆☆ Found in Text Mining only
Distal Myopathies	Distal myopathy	Pubtator	38079474	Associate	★☆☆☆☆ Found in Text Mining only
Distal myopathy Nonaka type	Distal myopathy	Pubtator	17279000, 18796596, 20020773, 22540328, 26208961, 34291734	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	20008652, 21968532		★☆☆☆☆ Found in Text Mining only
Dysarthria	Dysarthria	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dyscalculia	Dyscalculia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dysphasia	Dysphasia	BEFREE	27767988		★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	31174609, 31376286		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	22327514, 26227957		★☆☆☆☆ Found in Text Mining only
Familial Motor Neuron Disease	Motor Neuron Disease	BEFREE	18288693		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	34404366	Associate	★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	22072660		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	17279000, 17614162, 17917582, 17923628, 18068872, 18090423, 18304732, 18305110, 18505686, 18634762, 18703462, 18723384, 18723524, 18771956, 18796596, 18989115, 19104447, 19164285, 19271105, 19333444, 19336778, 19383787, 19465477, 19556136, 19609911, 19618231, 19655382, 19664364, 19674978, 19781077, 19805492, 19816201, 19910924, 20008652, 20083106, 20142524, 20154673, 20197701, 20202122, 20212429, 20234357, 20369906, 20413882, 20702714, 20864052, 20971753, 21086759, 21154232, 21173160, 21222600, 21326809, 21360076, 21482928, 21603977, 21607722, 21618003, 21678031, 21725240, 21783422, 21803454, 21811811, 21847013, 21881207, 21908872, 21944778, 21956718, 22029574, 22105541, 22411238, 22451909, 22473010, 22499346, 22506890, 22539017, 22550220, 22673113, 22732773, 22792076, 22804696, 22892647, 22903397, 23001869, 23023293, 23042786, 23124365, 23317354, 23415570, 23559573, 23575225, 23666556, 23689371, 23798570, 24035575, 24090760, 24143176, 24174584, 24286341, 24309270, 24355761, 24356984, 24442578, 24445903, 24462217, 24479957, 24494724, 24686783, 24709683, 24806671, 24860144, 24861427, 24898651, 24927705, 24931836, 24974230, 25085782, 25138285, 25215604, 25408367, 25442115, 25473830, 25503365, 25549971, 25556531, 25557955, 25604855, 25652699, 25819934, 25853458, 26002100, 26047658, 26159191, 26197969, 26410029, 26437864, 26476406, 26514432, 26555887, 26614389, 26900927, 26987909, 27015757, 27080313, 27138926, 27151080, 27193329, 27236050, 27338628, 27348499, 27445339, 27543771, 27563066, 27632209, 27928708, 27940503, 27956443, 28007900, 28122516, 28128723, 28129109, 28286471, 28304311, 28332094, 28334913, 28380257, 28405022, 28449882, 28663553, 28686708, 28751743, 28778989, 28842427, 28848086, 28852778, 28984110, 29053860, 29070802, 29079747, 29097807, 29134465, 29142232, 29191947, 29440230, 29545601, 29562314, 29578490, 29599716, 29630712, 29731706, 29755516, 29760282, 29954341, 29986938, 29987190, 30013506, 30030424, 30120199, 30239641, 30310141, 30315897, 30326935, 30333186, 30353006, 30355151, 30356856, 30357366, 30372676, 30373824, 30450515, 30486313, 30511086, 30643298, 30650353, 30667370, 30700593, 30728452, 30774737, 30785719, 30814253, 30824544, 30826182, 30853299, 30875670, 30922385, 30948513, 30949567, 30988363, 31018129, 31068973, 31132469, 31144027, 31213972, 31242080, 31259382, 31266542, 31333403, 31361008, 31382054, 31445085, 31495585, 31501924, 31605140, 31626287, 31626953, 31640103, 31640778, 31642482, 31690696, 31766750, 31780563, 31782904, 31847891		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	17279000, 17360763, 17591968, 18223198, 18723524, 18796596, 18802454, 19111550, 19411082, 19884571, 20361198, 20697052, 20855563, 20930269, 21172843, 21172844, 21232819, 21569259, 21803454, 21943958, 22051030, 22083254, 22121224, 22366792, 22367382, 22451909, 22506890, 22692064, 22892647, 23231971, 23575225, 23742080, 23759146, 23831027, 24143176, 24252534, 24252649, 24424030, 24462217, 24479957, 24686783, 24709683, 25122661, 25580532, 25635624, 25853458, 25943890, 26056265, 26102999, 26108573, 26538301, 27138926, 27151080, 27632209, 28158562, 28264768, 28282387, 28332094, 28666471, 28852778, 28912300, 29228211, 29562314, 29751289, 30003873, 30030424, 30120199, 30467822, 30511086, 30528349, 30643298, 30700593, 30704514, 30824544, 30981993, 30988363, 31361008, 31382054, 31605140, 31780563, 31855245, 31914217, 32330447, 32388566, 32500143, 32727073, 32790644, 32827688, 32843152, 32882370, 32887544, 32989039, 33151007, 33155043, 33242422, 33421065, 33427744, 33692125, 33694180, 33771571, 33803845, 34002018, 34333853, 34390468, 34561610, 34919645, 35152451, 35188955, 35197626, 35197628, 35231559, 35667216, 35835219, 35964197, 36103513, 36221381, 36261296, 36291062, 36474176, 36499048, 36499097, 36578035, 36827976, 36930291, 36930682, 37147573, 37466726, 37491327, 37522762, 37525358, 37527763, 37532939, 37914747, 38019311, 38175301, 38277467, 38320749, 40454469, 40713859	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Frontotemporal dementia	Frontotemporal dementia	GENOMICS_ENGLAND_DG	18372902, 20697052		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	30698757	Stimulate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	36217158	Inhibit	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Frontotemporal dementia	Frontotemporal dementia	HPO_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Frontotemporal Dementia With Motor Neuron Disease	Frontotemporal Dementia With Motor Neuron Disease	ORPHANET_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Frontotemporal dementia with motor neuron disease	Frontotemporal Dementia With Motor Neuron Disease	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FRONTOTEMPORAL DEMENTIA WITH TDP43 INCLUSIONS, TARDBP-RELATED	FRONTOTEMPORAL DEMENTIA WITH TDP43 INCLUSIONS	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	17023659, 17434264, 17509568, 17569064, 17591968, 17614162, 17764635, 17805587, 17826340, 17917583, 17984323, 18090423, 18223198, 18396105, 18438952, 18545701, 18592312, 18596549, 18684309, 18755042, 18771956, 18802454, 18974920, 18989115, 19018245, 19111550, 19139911, 19158106, 19217189, 19223871, 19237541, 19283396, 19285963, 19350673, 19379745, 19609911, 19618195, 19618231, 19664364, 19737636, 19786775, 19808791, 19821908, 19833869, 19847305, 20012109, 20047951, 20133711, 20154673, 20234357, 20369906, 20400460, 20415586, 20457961, 20472655, 20479359, 20490813, 20522652, 20551689, 20554523, 20555136, 20601083, 20645878, 20655970, 20720505, 20806063, 20881489, 20930269, 20937952, 20948999, 20951205, 20971753, 21031579, 21092856, 21123567, 21124004, 21154232, 21158017, 21178100, 21206091, 21222602, 21232819, 21289198, 21326809, 21339291, 21354975, 21355045, 21421050, 21424531, 21454607, 21482928, 21541367, 21554923, 21603977, 21607722, 21647631, 21666678, 21667065, 21673800, 21696412, 21752789, 21753175, 21777387, 21777389, 21777407, 21783422, 21787329, 21809041, 21833654, 21863317, 21908872, 21943958, 22098653, 22147697, 22154785, 22177996, 22181065, 22232551, 22235134, 22261247, 22342159, 22363618, 22366770, 22366791, 22398199, 22406069, 22411238, 22420316, 22424122, 22444279, 22451909, 22477152, 22506890, 22511793, 22512241, 22539017, 22563080, 22571983, 22647257, 22673113, 22674379, 22697423, 22702520, 22751173, 22804696, 22859297, 22892647, 22900631, 22944662, 22957047, 22970712, 22993125, 23041957, 23053136, 23124365, 23138004, 23300771, 23424178, 23457265, 23475610, 23543794, 23587065, 23609919, 23727833, 23742895, 23900071, 23922830, 24011641, 24019256, 24105464, 24132570, 24174584, 24252525, 24256250, 24312274, 24378564, 24381309, 24407427, 24477737, 24494724, 24497641, 24507191, 24591609, 24619111, 24651281, 24709683, 24806671, 24836899, 24860144, 24861427, 24915640, 24927705, 25056957, 25085782, 25185840, 25213598, 25342578, 25375143, 25410660, 25473830, 25549971, 25720411, 25788357, 25792726, 25853458, 26002100, 26089325, 26197969, 26220395, 26233805, 26327808, 26334913, 26437864, 26444430, 26476406, 26555887, 26811050, 26915990, 26936937, 26994698, 27226551, 27338935, 27563066, 27621269, 27662293, 27767988, 27858708, 27920024, 27997711, 28040728, 28100023, 28129109, 28167528, 28172957, 28301478, 28324764, 28330421, 28358904, 28444573, 28453527, 28487370, 28510586, 28594853, 28599005, 28611593, 28666471, 28687523, 28754988, 28854702, 28859337, 28859339, 28877758, 28960544, 28980860, 28984110, 28986472, 28987183, 29053860, 29078806, 29110334, 29215728, 29409526, 29421661, 29460270, 29578490, 29665116, 29715546, 29742622, 29750243, 29752072, 29778779, 29790198, 29802307, 29807909, 29878075, 29889265, 29912613, 29945202, 29970152, 30092839, 30103325, 30128653, 30255971, 30310141, 30324308, 30349851, 30353006, 30355151, 30357887, 30374726, 30399416, 30404641, 30467822, 30509290, 30520513, 30541625, 30559480, 30577465, 30604226, 30753613, 30774737, 30837838, 30851133, 30863908, 30922385, 30981993, 31020724, 31031584, 31100073, 31127776, 31144027, 31176717, 31213972, 31244341, 31259382, 31266542, 31287959, 31316455, 31350420, 31357627, 31373095, 31400306, 31501924, 31529970, 31555895, 31562527, 31626287, 31690171, 31766750		★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	CTD_human_DG	24019256, 24252504		★☆☆☆☆ Found in Text Mining only
FRONTOTEMPORAL LOBAR DEGENERATION WITH TDP43 INCLUSIONS, GRN-RELATED	Frontotemporal lobar degeneration with Tdp43 inclusions	BEFREE	17279000, 17917582, 17923628, 18304732, 18305110, 18505686, 18723384, 19164285, 19271105, 19333444, 19383787, 19465477, 19805492, 19816201, 20083106, 20142524, 20202122, 20702714, 21173160, 21678031, 21811811, 21847013, 21956718, 22029574, 22473010, 22506890, 23001869, 23317354, 27445339, 27928708, 28334913, 28842427, 30356856		★☆☆☆☆ Found in Text Mining only
FRONTOTEMPORAL LOBAR DEGENERATION WITH TDP43 INCLUSIONS, TARDBP-RELATED	TARDBP-related frontotemporal dementia	CLINVAR_DG	18309045, 19465477, 20154440, 20600671, 23401527, 23827948, 24143176, 24507191, 28430856, 28709720		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Ganglioneuroma	Ganglioneuroma	BEFREE	24080172		★☆☆☆☆ Found in Text Mining only
Generalized amyotrophy	Amyotrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28915616		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28915616		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	24870760, 37147573	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	18309045, 22029574		★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	HPO_DG			★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	22868089		★☆☆☆☆ Found in Text Mining only
Hepatic Adenomas Familial	Hepatic adenoma	Pubtator	19411082	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Sensory and Motor Neuropathy	Hereditary sensory and motor neuropathy	Pubtator	22883144	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	17984323, 19018245, 29134321		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	LHGDN	19018245		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	35409310	Associate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	25342578	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	38281298	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	18779421, 20008652, 22181065, 23747512, 23954172, 26639158, 28281308, 28521037, 28532818, 29382817, 29755516, 30452409, 31376286, 31386770, 31562527		★☆☆☆☆ Found in Text Mining only
INCLUSION BODY MYOPATHY WITH EARLY-ONSET PAGET DISEASE AND FRONTOTEMPORAL DEMENTIA	Inclusion Body Myopathy With Paget Disease And Frontotemporal Dementia	BEFREE	17457594, 18796596, 20008565, 20519548, 21222596, 23747512		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myopathy, Sporadic	Inclusion body myopathy	BEFREE	18796596, 19680126, 22860700, 24462217, 26785370, 28724966, 29780824, 30130494, 31406156		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	LHGDN	19066918		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	BEFREE	19533646, 22860700, 29653597, 30742062		★☆☆☆☆ Found in Text Mining only
Lafora Disease	Lafora Disease	BEFREE	20197701		★☆☆☆☆ Found in Text Mining only
Laryngospasm	Laryngospasm	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lateral Sclerosis	Lateral Sclerosis	BEFREE	22098653		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	19139911, 19816201, 20197701, 20551689, 25604855, 28205009, 28395086, 29878075, 30092839, 31127776		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	19816201, 25367383, 28395086, 32735084, 33771571, 33900085, 35810449	Associate	★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	20406184, 21857683, 31092554		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	37647804	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	37647804	Associate	★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	19618195, 20624952, 21294910, 21360076, 22550220, 23546887, 23818065, 23874513, 26452761, 26769969, 27906075, 29196813, 29786080, 29881994, 31017923, 31780563, 32887544, 33269497, 33694180, 34002018, 34333853, 35197628, 35426263, 35697676, 35787375, 35835219, 36233180, 36298819, 36633448, 37043475, 37522762, 37887320, 38019311, 38320749, 39769213	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31978067	Associate	★☆☆☆☆ Found in Text Mining only
Machado-Joseph Disease	Machado-Joseph Disease	BEFREE	23172908		★☆☆☆☆ Found in Text Mining only
Major depression, single episode	Mental Depression	BEFREE	30875670		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26902425		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26265046, 28952053		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26902425, 27786596, 28952053, 29421661, 29581274, 30394813		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	27786596		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	27786596	Associate	★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory disorders	Pubtator	24690380, 26224156, 33579840	Associate	★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	20937952		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	33003404	Associate	★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	26159191		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	27151080, 28794432, 29779213, 33647321, 35835219, 37647804, 37951930	Associate	★☆☆☆☆ Found in Text Mining only
Mood swings	Mood swings	HPO_DG			★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	17469116, 17543992, 19251628, 19379791, 21360076, 22156203, 22848727, 22883144, 23449777, 23559573, 25811799, 26108573, 26234214, 26294190, 27016404, 27178390, 27466204, 28633435, 29615863, 29630989, 29943193, 30625319, 31124187, 31319800, 31661035		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	LHGDN	17360763, 17569066, 18087705, 18288693		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Motor Neuron Disease	Motor neuron disease	Pubtator	17360763, 17579875, 17591968, 18288693, 18974920, 20697052, 21471218, 21569259, 22735976, 23558684, 24252649, 25788357, 25853458, 26303227, 26538301, 27929803, 29511089, 30267647, 30511086, 31017923, 31280399, 36215050	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Motor Neuron Disease	Motor Neuron Disease	BEFREE	17591968, 18288693, 18755042, 18974920, 19236453, 19496940, 19556136, 19655382, 19864663, 20055380, 20361056, 20551689, 20558162, 20667018, 20697052, 20720505, 21031579, 21233670, 22098653, 22127299, 22512241, 22571983, 22878865, 24252525, 24861427, 25185840, 25352065, 25429138, 25557955, 25853458, 26538301, 27590623, 27956443, 28343865, 28449882, 28859337, 29460270, 29511089, 29760195, 29886477, 30267647, 30511086, 30770445, 30773994, 30837838, 31017923, 31280399, 31696638		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Motor Neuron Disease	Motor Neuron Disease	CLINVAR_DG	28089114		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Multiple Sclerosis	Multiple sclerosis	Pubtator	32217641	Associate	★☆☆☆☆ Found in Text Mining only
Multiple System Atrophy	Multiple system atrophy	Pubtator	20142524, 29660838, 34255887	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Atrophy Spinal	Spinal muscular atrophy	Pubtator	21294910, 23155438, 30293881	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophies, Limb-Girdle	Limb-Girdle Muscular Dystrophy	BEFREE	26160665		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Facioscapulohumeral	Facioscapulohumeral muscular dystrophy	Pubtator	27906075	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Oculopharyngeal	Oculopharyngeal Muscular Dystrophy	BEFREE	22860700		★☆☆☆☆ Found in Text Mining only
Myofibrillar Myopathy	Myofibrillar myopathy	BEFREE	19533646, 29029362		★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	17279000, 18796596, 19533646, 20621187, 22860700, 24462217, 30130494, 30471417, 30979586		★☆☆☆☆ Found in Text Mining only
MYOPATHY, DISTAL 2	MYOPATHY	BEFREE	26493020		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	19533646		★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	18796596, 24462217, 29780824	Associate	★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	29653597	Stimulate	★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	Pubtator	19687452	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	21471218	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27786596, 29499929		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	30643292, 31780563, 32735084, 37147573	Associate	★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	18372902, 19959528, 22398199, 23900071, 24806671, 26226329, 28330421, 29807909, 30810811, 30863908, 30992467		★☆☆☆☆ Found in Text Mining only
Neu-Laxova syndrome	Neu-Laxova Syndrome	BEFREE	28040728		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	21421050, 22493728, 23798570, 24477737, 26123670, 26902425, 28158562, 29125873, 29379112, 31357627, 31663379		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	28158562	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	17898224, 17936612, 18288693, 18396105, 18703504, 18779421, 18802454, 19111550, 19237541, 19383787, 20855563, 21031599, 21131904, 22121224, 22323604, 22451909, 22473010, 22584570, 23048034, 23138004, 23704877, 24220679, 24462217, 24464995, 24497641, 24591609, 24870760, 25375143, 25503365, 26261209, 26538301, 26769969, 26883171, 26980269, 28122516, 28167528, 28467899, 28510586, 28793209, 29779213, 29881994, 30087231, 30120199, 30367664, 30390709, 30511086, 30520513, 30643298, 30824544, 30863908, 31017923, 31042469, 31235914, 31350420, 31382054, 31527135, 31653829, 31863590, 32217641, 32882370, 32989039, 33144500, 33151007, 33433033, 33694180, 33900085, 34035398, 34291734, 34586830, 34769284, 35697676, 35810449, 35835219, 35963893, 36062323, 36930291, 37131250, 37150879, 37532939, 37647804, 37949836, 38139294, 38308693, 39251571, 39302099, 39349456, 40243477, 40454469	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	17023659, 17591968, 18068872, 18549326, 18592312, 18684309, 18723524, 18802454, 18845250, 18929508, 18989115, 19018245, 19271105, 19283396, 19737636, 19741216, 19781077, 19833869, 20031275, 20083106, 20133711, 20234357, 20361056, 20400460, 20551689, 20554523, 20601083, 20655970, 20702714, 20721566, 20740007, 20806063, 21031599, 21086759, 21123567, 21173160, 21339291, 21355045, 21358643, 21360076, 21673800, 21706176, 21777389, 21783422, 22028183, 22029574, 22079416, 22127299, 22147697, 22232551, 22235134, 22363618, 22473010, 22584570, 22697423, 22761693, 22792076, 22848727, 22957047, 22970712, 23124365, 23138004, 23258539, 23317354, 23384725, 23559573, 23567652, 23587065, 23721326, 23727833, 23742895, 23867462, 23954172, 24019256, 24462217, 24497641, 24591609, 24806671, 24860144, 24870760, 24920338, 25088712, 25213598, 25359468, 25375143, 25473830, 25503365, 25720411, 25792726, 26002100, 26037142, 26047658, 26130692, 26160665, 26233805, 26441009, 26702100, 26735904, 26915990, 27101846, 27348499, 27370226, 27452472, 27935101, 27998621, 28000730, 28122516, 28129109, 28335005, 28358904, 28380257, 28467899, 28510586, 28537433, 28600885, 28611593, 28657719, 28686708, 28711596, 28751743, 28754988, 28793209, 28793370, 28805003, 28833982, 28842427, 28847811, 28852778, 28915616, 29097807, 29153610, 29279008, 29421661, 29431050, 29472250, 29486049, 29555476, 29556029, 29652933, 29765078, 29779213, 29802307, 29878075, 29943193, 30120199, 30128653, 30233682, 30297502, 30309612, 30315897, 30356856, 30357366, 30390709, 30413172, 30450515, 30520297, 30520513, 30660504, 30692134, 30723395, 30814253, 30824544, 30905713, 30948513, 31034749, 31035038, 31068973, 31079926, 31100073, 31176717, 31213972, 31287959, 31310801, 31316455, 31355778, 31357627, 31376286, 31382054, 31430111, 31445085, 31479821, 31642482, 31690171, 31780563, 31846303		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Disorders	Neurodegenerative Disorders	LHGDN	18549326, 18592312, 18657254, 18929508		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuromuscular Diseases	Neuromuscular Diseases	BEFREE	30464263		★☆☆☆☆ Found in Text Mining only
Neuronal Ceroid-Lipofuscinoses	Neuronal Ceroid Lipofuscinosis	BEFREE	25022663, 28778989, 29036611		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	30404641, 30643292		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	27193329		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26265046, 31081093		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	24898651		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	26037142		★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	17279000		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	34823271	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	18389263, 20197701, 20551689, 21667065, 22398199, 22647257, 23062702, 23124365, 23231971, 23546887, 25604855, 25720411, 28395086, 29272468, 29801890, 30092839, 31132469, 31404106, 31820696		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	18389263, 19006185, 21667065, 21803454, 23231971, 23546887, 33771571, 34880495, 40488901	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease Secondary	Secondary parkinson disease	Pubtator	21667065, 23231971, 23546887, 25853458, 35286755, 40488901	Associate	★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	20031275, 29801890		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	19283396, 20142524, 21667065, 23231971, 23546887, 24262168, 26373655, 29801890		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Peripheral motor neuropathy	Motor nerve neuritis	BEFREE	29029362		★☆☆☆☆ Found in Text Mining only
Perry Syndrome	Perry Syndrome	BEFREE	28625517, 28789478, 29273399		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	17279000, 17614162, 18634762, 18723524, 18796596, 18989115, 19104447, 19609911, 19655382, 19664364, 19781077, 19910924, 20008652, 20197701, 20864052, 21086759, 21908872, 22673113, 22792076, 22892647, 22903397, 23023293, 23415570, 23575225, 23689371, 23798570, 24309270, 24462217, 24686783, 24709683, 24927705, 25408367, 25442115, 25503365, 25604855, 25652699, 25819934, 25853458, 26047658, 26514432, 26614389, 26987909, 27015757, 27138926, 27236050, 27338628, 27543771, 27940503, 28122516, 28304311, 28405022, 28663553, 28686708, 28848086, 28984110, 29070802, 29545601, 29562314, 29878075, 29986938, 29987190, 30120199, 30239641, 30333186, 30355151, 30357366, 30372676, 30450515, 30785719, 30814253, 30824544, 30826182, 30853299, 30922385, 30948513, 30988363, 31259382, 31382054, 31640103, 31642482, 31690696, 31766750, 31780563, 31782904		★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	24806671		★☆☆☆☆ Found in Text Mining only
Polyglucosan Body Disease, Adult Form	Polyglucosan body myopathy	BEFREE	22506890		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	22860700		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	17469116, 18505686, 19283396, 19851068, 20697052, 21471218, 22848727, 23084342, 23172908, 24927705, 25215604, 26159191, 27015757, 27543771, 28176659, 29053785, 29511089, 29556029, 29614661, 29944741, 30010126, 30396335, 30753613, 31376286, 31562527		★☆☆☆☆ Found in Text Mining only
Primary Progressive Aphasia (disorder)	Aphasia	BEFREE	20479359, 26791154, 29305438, 29584904, 29665116, 29935415, 30255971, 30599136, 30753613, 30851133, 31640103, 31747857		★☆☆☆☆ Found in Text Mining only
Primary Progressive Nonfluent Aphasia	Nonfluent Aphasia	BEFREE	22647257, 28100023, 30013506		★☆☆☆☆ Found in Text Mining only
Prion Diseases	Prion disease	Pubtator	34035398	Inhibit	★☆☆☆☆ Found in Text Mining only
Progressive cerebellar ataxia	Cerebellar Ataxia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Progressive Muscular Atrophy	Progressive Muscular Atrophy	BEFREE	28456383		★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	LHGDN	19139310		★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	21908872, 24479957, 25352065, 26159191, 29630712, 29878075		★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy atypical	Progressive supranuclear palsy	Pubtator	20142524	Associate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	24898651		★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Reactive systemic amyloidosis	Reactive Systemic Amyloidosis	BEFREE	25907990		★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	18779421		★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	22993125		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	19336778, 31382054		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	31382054	Associate	★☆☆☆☆ Found in Text Mining only
Semantic Dementia	Semantic Dementia	BEFREE	28100023, 28666471, 28912300, 30013506		★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	18634762, 30670070		★☆☆☆☆ Found in Text Mining only
Sensorineural hearing loss, bilateral	Sensorineural hearing loss	HPO_DG			★☆☆☆☆ Found in Text Mining only
Severe Aplastic Anemia	Anemia	BEFREE	25907990		★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia Hereditary	Hereditary spastic paraplegia	Pubtator	22302102	Associate	★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	22072660, 23255347, 27466204		★☆☆☆☆ Found in Text Mining only
SPINOCEREBELLAR ATAXIA 31 (disorder)	Spinocerebellar Ataxia	BEFREE	28343865, 31755042		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 2	Spinocerebellar Ataxia	BEFREE	20740007, 22868089, 24718895		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxias	Spinocerebellar ataxia	Pubtator	33284045	Associate	★☆☆☆☆ Found in Text Mining only
Stereotyped Behavior	Stereotyped Behavior	HPO_DG			★☆☆☆☆ Found in Text Mining only
Strudwick syndrome	Strudwick Syndrome	BEFREE	19884571		★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	30233682		★☆☆☆☆ Found in Text Mining only
Supranuclear Palsy Progressive	Progressive supranuclear palsy	Pubtator	21908872, 24479957, 29926172, 31999351, 35842134	Associate	★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	18596549, 20881489, 21833654, 23666556, 24313828, 24861427, 27502124, 28416393, 28487370, 28550263, 29807909, 29878075, 30382507		★☆☆☆☆ Found in Text Mining only
Torsades de Pointes	Torsades de pointes	Pubtator	29926172, 30909235, 32778941, 40478310	Associate	★☆☆☆☆ Found in Text Mining only
Torsades de Pointes	Torsades de pointes	Pubtator	33969528	Stimulate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29581274, 31062657		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	29581274, 35504883	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular fibrillation	Pubtator	30520303	Associate	★☆☆☆☆ Found in Text Mining only