SIRT3 (sirtuin 3)

Gene

• Entrez ID: 23410
• Gene name: Sirtuin 3
• Gene symbol: SIRT3
• Synonyms (NCBI Gene): SIR2L3
• Chromosome: 11
• Chromosome location: 11p15.5
• Summary: SIRT3 encodes a member of the sirtuin family of class III histone deacetylases, homologs to the yeast Sir2 protein. The encoded protein is found exclusively in mitochondria, where it can eliminate reactive oxygen species, inhibit apoptosis, and prevent th

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT732205	hsa-miR-421	Luciferase reporter assay	27107702
MIRT732205	hsa-miR-421	Luciferase reporter assay	27107702
MIRT734872	hsa-miR-505-3p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), Immunocytochemistry (ICC)	33385630
MIRT734872	hsa-miR-505-3p	Luciferase reporter assay, Western blotting, qRT-PCR	34646424
MIRT1350159	hsa-miR-1	CLIP-seq
MIRT1350160	hsa-miR-106a	CLIP-seq
MIRT1350161	hsa-miR-106b	CLIP-seq
MIRT1350162	hsa-miR-1225-5p	CLIP-seq
MIRT1350163	hsa-miR-128	CLIP-seq
MIRT1350164	hsa-miR-1287	CLIP-seq
MIRT1350165	hsa-miR-1298	CLIP-seq
MIRT1350166	hsa-miR-1299	CLIP-seq
MIRT1350167	hsa-miR-17	CLIP-seq
MIRT1350168	hsa-miR-185	CLIP-seq
MIRT1350169	hsa-miR-206	CLIP-seq
MIRT1350170	hsa-miR-20a	CLIP-seq
MIRT1350171	hsa-miR-20b	CLIP-seq
MIRT1350172	hsa-miR-24	CLIP-seq
MIRT1350173	hsa-miR-302a	CLIP-seq
MIRT1350174	hsa-miR-302b	CLIP-seq
MIRT1350175	hsa-miR-302c	CLIP-seq
MIRT1350176	hsa-miR-302d	CLIP-seq
MIRT1350177	hsa-miR-302e	CLIP-seq
MIRT1350178	hsa-miR-3122	CLIP-seq
MIRT1350179	hsa-miR-3135b	CLIP-seq
MIRT1350180	hsa-miR-3150b-3p	CLIP-seq
MIRT1350181	hsa-miR-3655	CLIP-seq
MIRT1350182	hsa-miR-3673	CLIP-seq
MIRT1350183	hsa-miR-3685	CLIP-seq
MIRT1350184	hsa-miR-3689a-3p	CLIP-seq
MIRT1350185	hsa-miR-3689c	CLIP-seq
MIRT1350186	hsa-miR-372	CLIP-seq
MIRT1350187	hsa-miR-373	CLIP-seq
MIRT1350188	hsa-miR-384	CLIP-seq
MIRT1350189	hsa-miR-3913-5p	CLIP-seq
MIRT1350190	hsa-miR-3929	CLIP-seq
MIRT1350191	hsa-miR-4269	CLIP-seq
MIRT1350192	hsa-miR-4272	CLIP-seq
MIRT1350193	hsa-miR-4284	CLIP-seq
MIRT1350194	hsa-miR-4306	CLIP-seq
MIRT1350195	hsa-miR-4323	CLIP-seq
MIRT1350196	hsa-miR-4328	CLIP-seq
MIRT1350197	hsa-miR-4419b	CLIP-seq
MIRT1350198	hsa-miR-4434	CLIP-seq
MIRT1350199	hsa-miR-4478	CLIP-seq
MIRT1350200	hsa-miR-450b-3p	CLIP-seq
MIRT1350201	hsa-miR-4514	CLIP-seq
MIRT1350202	hsa-miR-4516	CLIP-seq
MIRT1350203	hsa-miR-4637	CLIP-seq
MIRT1350204	hsa-miR-4640-5p	CLIP-seq
MIRT1350205	hsa-miR-4644	CLIP-seq
MIRT1350206	hsa-miR-4645-5p	CLIP-seq
MIRT1350207	hsa-miR-4673	CLIP-seq
MIRT1350208	hsa-miR-4692	CLIP-seq
MIRT1350209	hsa-miR-4709-5p	CLIP-seq
MIRT1350210	hsa-miR-4726-5p	CLIP-seq
MIRT1350211	hsa-miR-4728-5p	CLIP-seq
MIRT1350212	hsa-miR-4742-5p	CLIP-seq
MIRT1350213	hsa-miR-4755-3p	CLIP-seq
MIRT1350214	hsa-miR-4768-3p	CLIP-seq
MIRT1350215	hsa-miR-4782-5p	CLIP-seq
MIRT1350216	hsa-miR-4784	CLIP-seq
MIRT1350217	hsa-miR-4802-5p	CLIP-seq
MIRT1350218	hsa-miR-485-5p	CLIP-seq
MIRT1350219	hsa-miR-496	CLIP-seq
MIRT1350220	hsa-miR-512-3p	CLIP-seq
MIRT1350221	hsa-miR-516b	CLIP-seq
MIRT1350222	hsa-miR-519d	CLIP-seq
MIRT1350223	hsa-miR-520a-3p	CLIP-seq
MIRT1350224	hsa-miR-520b	CLIP-seq
MIRT1350225	hsa-miR-520c-3p	CLIP-seq
MIRT1350226	hsa-miR-520d-3p	CLIP-seq
MIRT1350227	hsa-miR-520e	CLIP-seq
MIRT1350228	hsa-miR-613	CLIP-seq
MIRT1350229	hsa-miR-661	CLIP-seq
MIRT1350230	hsa-miR-665	CLIP-seq
MIRT1350231	hsa-miR-765	CLIP-seq
MIRT1350232	hsa-miR-769-3p	CLIP-seq
MIRT1350233	hsa-miR-875-3p	CLIP-seq
MIRT1350234	hsa-miR-93	CLIP-seq
MIRT1350163	hsa-miR-128	CLIP-seq
MIRT1350235	hsa-miR-186	CLIP-seq
MIRT1350236	hsa-miR-1912	CLIP-seq
MIRT1350237	hsa-miR-203	CLIP-seq
MIRT1350172	hsa-miR-24	CLIP-seq
MIRT1350238	hsa-miR-3130-5p	CLIP-seq
MIRT1350239	hsa-miR-3133	CLIP-seq
MIRT1350191	hsa-miR-4269	CLIP-seq
MIRT1350193	hsa-miR-4284	CLIP-seq
MIRT1350240	hsa-miR-4482	CLIP-seq
MIRT1350241	hsa-miR-4635	CLIP-seq
MIRT1350204	hsa-miR-4640-5p	CLIP-seq
MIRT1350206	hsa-miR-4645-5p	CLIP-seq
MIRT1350207	hsa-miR-4673	CLIP-seq
MIRT1350210	hsa-miR-4726-5p	CLIP-seq
MIRT1350213	hsa-miR-4755-3p	CLIP-seq
MIRT1350214	hsa-miR-4768-3p	CLIP-seq
MIRT1350230	hsa-miR-665	CLIP-seq
MIRT1350166	hsa-miR-1299	CLIP-seq
MIRT1350168	hsa-miR-185	CLIP-seq
MIRT2103740	hsa-miR-3120-3p	CLIP-seq
MIRT1350180	hsa-miR-3150b-3p	CLIP-seq
MIRT1350190	hsa-miR-3929	CLIP-seq
MIRT1350194	hsa-miR-4306	CLIP-seq
MIRT1350197	hsa-miR-4419b	CLIP-seq
MIRT1350199	hsa-miR-4478	CLIP-seq
MIRT2103741	hsa-miR-4501	CLIP-seq
MIRT1350201	hsa-miR-4514	CLIP-seq
MIRT1350205	hsa-miR-4644	CLIP-seq
MIRT1350208	hsa-miR-4692	CLIP-seq
MIRT2103742	hsa-miR-4709-3p	CLIP-seq
MIRT1350209	hsa-miR-4709-5p	CLIP-seq
MIRT1350215	hsa-miR-4782-5p	CLIP-seq
MIRT1350216	hsa-miR-4784	CLIP-seq
MIRT1350217	hsa-miR-4802-5p	CLIP-seq
MIRT1350218	hsa-miR-485-5p	CLIP-seq
MIRT1350219	hsa-miR-496	CLIP-seq
MIRT2103743	hsa-miR-505	CLIP-seq
MIRT1350221	hsa-miR-516b	CLIP-seq
MIRT2103744	hsa-miR-545	CLIP-seq
MIRT1350231	hsa-miR-765	CLIP-seq
MIRT2327876	hsa-miR-1265	CLIP-seq
MIRT2327877	hsa-miR-127-5p	CLIP-seq
MIRT2327878	hsa-miR-1293	CLIP-seq
MIRT1350178	hsa-miR-3122	CLIP-seq
MIRT2327879	hsa-miR-3165	CLIP-seq
MIRT2327880	hsa-miR-3173-3p	CLIP-seq
MIRT2327881	hsa-miR-323b-3p	CLIP-seq
MIRT2327882	hsa-miR-3605-5p	CLIP-seq
MIRT2327883	hsa-miR-3614-5p	CLIP-seq
MIRT2327884	hsa-miR-3665	CLIP-seq
MIRT1350184	hsa-miR-3689a-3p	CLIP-seq
MIRT1350185	hsa-miR-3689c	CLIP-seq
MIRT2327885	hsa-miR-3691-5p	CLIP-seq
MIRT1350189	hsa-miR-3913-5p	CLIP-seq
MIRT2327886	hsa-miR-3926	CLIP-seq
MIRT2327887	hsa-miR-3944-5p	CLIP-seq
MIRT2327888	hsa-miR-4277	CLIP-seq
MIRT2327889	hsa-miR-4419a	CLIP-seq
MIRT2327890	hsa-miR-4483	CLIP-seq
MIRT2327891	hsa-miR-4491	CLIP-seq
MIRT2327892	hsa-miR-4510	CLIP-seq
MIRT1350201	hsa-miR-4514	CLIP-seq
MIRT2327893	hsa-miR-4533	CLIP-seq
MIRT1350241	hsa-miR-4635	CLIP-seq
MIRT2327894	hsa-miR-4657	CLIP-seq
MIRT1350208	hsa-miR-4692	CLIP-seq
MIRT1350211	hsa-miR-4728-5p	CLIP-seq
MIRT2327895	hsa-miR-4752	CLIP-seq
MIRT2327896	hsa-miR-4764-5p	CLIP-seq
MIRT2327897	hsa-miR-4786-3p	CLIP-seq
MIRT2327898	hsa-miR-4786-5p	CLIP-seq
MIRT2327899	hsa-miR-548p	CLIP-seq
MIRT2327900	hsa-miR-548s	CLIP-seq
MIRT2327901	hsa-miR-657	CLIP-seq
MIRT1350230	hsa-miR-665	CLIP-seq
MIRT1350180	hsa-miR-3150b-3p	CLIP-seq
MIRT1350216	hsa-miR-4784	CLIP-seq
MIRT1350235	hsa-miR-186	CLIP-seq
MIRT1350237	hsa-miR-203	CLIP-seq
MIRT1350239	hsa-miR-3133	CLIP-seq
MIRT2459420	hsa-miR-4520a-3p	CLIP-seq
MIRT2459421	hsa-miR-4520b-3p	CLIP-seq
MIRT2459422	hsa-miR-4529-3p	CLIP-seq
MIRT1350241	hsa-miR-4635	CLIP-seq
MIRT2459423	hsa-miR-494	CLIP-seq
MIRT1350162	hsa-miR-1225-5p	CLIP-seq
MIRT2327877	hsa-miR-127-5p	CLIP-seq
MIRT2622879	hsa-miR-1291	CLIP-seq
MIRT2327878	hsa-miR-1293	CLIP-seq
MIRT1350235	hsa-miR-186	CLIP-seq
MIRT1350237	hsa-miR-203	CLIP-seq
MIRT2622880	hsa-miR-2861	CLIP-seq
MIRT1350178	hsa-miR-3122	CLIP-seq
MIRT2622881	hsa-miR-3127-5p	CLIP-seq
MIRT1350239	hsa-miR-3133	CLIP-seq
MIRT2327879	hsa-miR-3165	CLIP-seq
MIRT2622882	hsa-miR-328	CLIP-seq
MIRT2327883	hsa-miR-3614-5p	CLIP-seq
MIRT1350184	hsa-miR-3689a-3p	CLIP-seq
MIRT1350185	hsa-miR-3689c	CLIP-seq
MIRT1350189	hsa-miR-3913-5p	CLIP-seq
MIRT2622883	hsa-miR-3918	CLIP-seq
MIRT2622884	hsa-miR-4446-3p	CLIP-seq
MIRT2327890	hsa-miR-4483	CLIP-seq
MIRT2622885	hsa-miR-4492	CLIP-seq
MIRT2622886	hsa-miR-4498	CLIP-seq
MIRT2103741	hsa-miR-4501	CLIP-seq
MIRT2622887	hsa-miR-4505	CLIP-seq
MIRT2459421	hsa-miR-4520b-3p	CLIP-seq
MIRT2459422	hsa-miR-4529-3p	CLIP-seq
MIRT1350241	hsa-miR-4635	CLIP-seq
MIRT2622888	hsa-miR-4651	CLIP-seq
MIRT1350211	hsa-miR-4728-5p	CLIP-seq
MIRT2622889	hsa-miR-4732-3p	CLIP-seq
MIRT2327897	hsa-miR-4786-3p	CLIP-seq
MIRT2622890	hsa-miR-4792	CLIP-seq
MIRT2459423	hsa-miR-494	CLIP-seq
MIRT2622891	hsa-miR-608	CLIP-seq
MIRT1350229	hsa-miR-661	CLIP-seq
MIRT2622892	hsa-miR-663b	CLIP-seq
MIRT2622893	hsa-miR-762	CLIP-seq
MIRT2327877	hsa-miR-127-5p	CLIP-seq
MIRT2327878	hsa-miR-1293	CLIP-seq
MIRT1350235	hsa-miR-186	CLIP-seq
MIRT1350237	hsa-miR-203	CLIP-seq
MIRT1350178	hsa-miR-3122	CLIP-seq
MIRT1350239	hsa-miR-3133	CLIP-seq
MIRT2327879	hsa-miR-3165	CLIP-seq
MIRT2327883	hsa-miR-3614-5p	CLIP-seq
MIRT1350184	hsa-miR-3689a-3p	CLIP-seq
MIRT1350185	hsa-miR-3689c	CLIP-seq
MIRT1350189	hsa-miR-3913-5p	CLIP-seq
MIRT2327886	hsa-miR-3926	CLIP-seq
MIRT2327890	hsa-miR-4483	CLIP-seq
MIRT1350241	hsa-miR-4635	CLIP-seq
MIRT1350211	hsa-miR-4728-5p	CLIP-seq
MIRT2327897	hsa-miR-4786-3p	CLIP-seq
MIRT2327898	hsa-miR-4786-5p	CLIP-seq
MIRT2459423	hsa-miR-494	CLIP-seq
MIRT2327899	hsa-miR-548p	CLIP-seq
MIRT2327900	hsa-miR-548s	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	TAS	17456799
GO:0005515	Function	Protein binding	IPI	16788062, 19343720, 19535340, 22770219, 23283301, 24344202, 29445193, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	16079181
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	IMP	25023514
GO:0005759	Component	Mitochondrial matrix	IDA	12186850, 29445193
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0006476	Process	Protein deacetylation	IDA	16788062
GO:0008270	Function	Zinc ion binding	IDA	19535340
GO:0009060	Process	Aerobic respiration	IMP	22309213
GO:0016740	Function	Transferase activity	IEA
GO:0016747	Function	Acyltransferase activity, transferring groups other than amino-acyl groups	IEA
GO:0017136	Function	Histone deacetylase activity, NAD-dependent	IBA
GO:0019899	Function	Enzyme binding	IEA
GO:0032024	Process	Positive regulation of insulin secretion	IEA
GO:0032991	Component	Protein-containing complex	IDA	23283301, 29445193
GO:0033554	Process	Cellular response to stress	TAS
GO:0033558	Function	Protein lysine deacetylase activity	TAS
GO:0034979	Function	NAD-dependent protein lysine deacetylase activity	IEA
GO:0034979	Function	NAD-dependent protein lysine deacetylase activity	IMP	25023514
GO:0034979	Function	NAD-dependent protein lysine deacetylase activity	ISS
GO:0034979	Function	NAD-dependent protein lysine deacetylase activity	TAS
GO:0034983	Process	Peptidyl-lysine deacetylation	IMP	22309213
GO:0034983	Process	Peptidyl-lysine deacetylation	ISS
GO:0043565	Function	Sequence-specific DNA binding	IDA	29445193
GO:0046872	Function	Metal ion binding	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0070403	Function	NAD+ binding	IEA
GO:0141208	Function	NAD-dependent protein lysine delactylase activity	IDA	36896611, 37720100
GO:0141208	Function	NAD-dependent protein lysine delactylase activity	IEA
GO:1901671	Process	Positive regulation of superoxide dismutase activity	IDA	25210848
GO:1902553	Process	Positive regulation of catalase activity	IDA	25210848
GO:1903862	Process	Positive regulation of oxidative phosphorylation	IMP	25023514
GO:1990404	Function	NAD+-protein mono-ADP-ribosyltransferase activity	TAS	17456799
GO:2000304	Process	Positive regulation of ceramide biosynthetic process	ISS
GO:2000378	Process	Negative regulation of reactive oxygen species metabolic process	IEA

Other IDs

• MIM: 604481
• HGNC: 14931
• e!Ensembl: ENSG00000142082

Protein

• UniProt ID: Q9NTG7
• Protein name: NAD-dependent protein deacetylase sirtuin-3, mitochondrial (hSIRT3) (EC 2.3.1.286) (NAD-dependent protein delactylase sirtuin-3) (EC 2.3.1.-) (Regulatory protein SIR2 homolog 3) (SIR2-like protein 3)
• Protein function: NAD-dependent protein deacetylase (PubMed:12186850, PubMed:12374852, PubMed:16788062, PubMed:18680753, PubMed:18794531, PubMed:19535340, PubMed:23283301, PubMed:24121500, PubMed:24252090). Activates or deactivates mitochondrial target proteins b
• PDB: 3GLR, 3GLS, 3GLT, 3GLU, 4BN4, 4BN5, 4BV3, 4BVB, 4BVE, 4BVF, 4BVG, 4BVH, 4C78, 4C7B, 4FVT, 4FZ3, 4HD8, 4JSR, 4JT8, 4JT9, 4O8Z, 5BWN, 5BWO, 5D7N, 5H4D, 5Y4H, 5YTK, 5Z93, 5Z94, 5ZGC, 6ISO, 8ANC, 8BBK, 8CCW, 8CCZ, 8HLW, 8HLY, 8HN9, 8V15, 8V2N, 8V5U, 9CBT
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02146	SIR2	145 → 326	Sir2 family	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:10381378, ECO:0000269|PubMed:12374852}.
• Sequence:

  MAFWGWRAAAALRLWGRVVERVEAGGGVGPFQACGCRLVLGGRDDVSAGLRGSHGARGEP
  LDPARPLQRPPRPEVPRAFRRQPRAAAPSFFFSSIKGGRRSISFSVGASSVVGSGGSSDK
  GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIF
  ELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIP
  ASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQ
  RFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDV
  AQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK

• Sequence length: 399

Pathways

KEGG:

Nicotinate and nicotinamide metabolism
Metabolic pathways
Central carbon metabolism in cancer

Reactome:

Transcriptional activation of mitochondrial biogenesis
FOXO-mediated transcription of oxidative stress, metabolic and neuronal genes
Regulation of FOXO transcriptional activity by acetylation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BENIGN PROSTATIC HYPERPLASIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ANEURYSM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, SQUAMOUS CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES, GESTATIONAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GESTATIONAL DIABETES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOUTH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SIRT3-related disorder	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	31236919		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23842789		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	31370365	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	32104538, 32747616	Inhibit	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	29324783		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	28239025	Inhibit	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	28239025	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	28449871, 28603486		★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	36991356	Inhibit	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	27063143, 28467723, 30254716, 30458637, 31696493		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	33530998	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	27063143, 28467723, 30254716, 30458637, 31696493		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	35791925	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	31227513		★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	29862442		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	23612572	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23598413, 23842789, 23856293, 24746213, 25562154, 25855962, 26141949, 27420645, 29466723, 29713184, 29915029		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17003781	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23598413, 24746213, 25556440, 25562154, 27165221, 27270321, 29915029, 36974538	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24448804	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22674009, 23272146, 23800187, 30715550, 34232204	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	24287180, 26317998		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	26631040	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23272146, 23790338, 24774224, 27367026, 28338198, 28985579, 30917505, 32306906, 36308411, 38548246	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28347248	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	35392973	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25755722, 37996927	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37096064	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	26631040		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	27216459, 27277143, 31113446, 31547300		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	22394676, 28423723, 28724806, 31201798		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	33303703	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	27794418, 28480597, 29674007, 30487434		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	27078640, 27128560, 28804544, 29643974, 30132870, 30458637, 30510203, 30618267		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	36083252	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	28396174		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	28965081, 36012382	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	26620563, 29302794, 29311941, 29444200, 29777578		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30695683, 31677030		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	31677030		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30695683, 31677030		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	30993888		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	29713184		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	28951138		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	29238464		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	28935184		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	31652451		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	26141949, 29323702, 29374515, 29713184		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29650970, 30021354, 30367038		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25105144, 31188638, 32312920, 32811824, 34747319, 35122251, 35440893, 36594098, 36871142, 37789393, 39291655	Associate	★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	30993888		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28302481, 28804553, 30132870, 30458637, 31464387		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29713184, 30095923		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	27128560, 28500761, 30042676, 30227330, 30485429		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	30227330		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	35224092	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	35791925	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	30227330		★☆☆☆☆ Found in Text Mining only
Coronary Thrombosis	Coronary Thrombosis	BEFREE	29444200		★☆☆☆☆ Found in Text Mining only
Cytochrome-c Oxidase Deficiency	Cytochrome-C Oxidase Deficiency	BEFREE	29059204		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	30031925, 30237062, 30443190, 30584213		★☆☆☆☆ Found in Text Mining only
Delirium, Dementia, Amnestic, Cognitive Disorders	Delirium, Dementia, Amnestic, Cognitive Disorders	BEFREE	31652451		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	27888691, 28249157, 29689547, 30250024, 31207226, 31318577, 31425381, 31557786		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	25755722	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	27888691, 28249157, 29689547, 30250024, 31207226, 31318577, 31425381, 31557786		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	30736780, 36010644	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	30917505, 32377289	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	30736780, 35409099	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	30736780, 35409099, 35791925	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	33191653	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30736780, 30846716		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	21331741, 23397292, 25915406, 28375738, 29435415, 30385301, 30683904		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	38175638	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	28965951, 29674007, 31318577		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	33096729	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	34278469	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	30683904		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	30572719, 30846716		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	33423553, 38175638	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	31185214		★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	27856259		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	26332421	Associate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	30355082		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	26701732		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	26701732	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	35980861	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	29778462		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	21856199, 28808064, 29581157		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	29224910		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30502394, 31742890		★☆☆☆☆ Found in Text Mining only
Friedreich Ataxia	Friedreich Ataxia	BEFREE	28724806		★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	22394676, 28542596		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30119208, 30683653, 30691320		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29336479, 30119208, 30683653, 30691320		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27270321, 28567457, 36809279	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30119208, 30464504, 30683653		★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	30389773		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	25755722, 38330708	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	27614093, 29643974, 30131726		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28302481, 28804553, 30132870, 30458637, 31464387		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	28527050		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	27686535, 28603486, 29129747, 30019499		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29689547, 29970985, 30846716, 31184932		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	38175638	Associate	★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	30084918		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	28375738, 29277324, 30868489, 31184932		★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	29070699	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28465484, 28684630, 30458637, 30618267, 30717220, 31189433, 31425381		★☆☆☆☆ Found in Text Mining only
hypertensive nephropathy	Hypertensive Nephropathy	BEFREE	28465484		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	30736780	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	27270321, 35042949	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	25284742, 28680578, 31749139		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30390331		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29765980, 30296006		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	35409099	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	30420619, 31773668		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	29371936		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28965081, 29311941, 29777578, 31729962		★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	30548662, 30588609, 30674870		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	21664458, 26972664		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	25607838, 28424621, 28698153, 29042548, 30442253, 30445987, 30487750, 30502252, 30797821		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	30095923		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	39736018	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	32486166	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	37021547	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	31236919		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	31055111		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22609775, 23272146, 23842789, 24774224, 25961022, 28338198, 28347248, 28527050, 28985579, 29713184, 30917505, 31076630		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	29238464		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	31076630		★☆☆☆☆ Found in Text Mining only
Long chain acyl-CoA dehydrogenase deficiency	Acyl CoA Dehydrogenase Deficiency	BEFREE	29727630		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	35042949	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24042441	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	34232204	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25105144, 25562154, 28947845, 34232204	Associate	★☆☆☆☆ Found in Text Mining only
Macular dystrophy retinal 1 North Carolina type	Macular dystrophy	Pubtator	33423553	Inhibit	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21397863, 23842789, 23856293, 24448804, 24746213, 25562154, 25855962, 26141949, 27420645, 29466723, 29713184, 29915029		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	26701732		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	30095923		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	CTD_human_DG	21472714		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	27216459, 27277143, 31113446, 31547300		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	24909164, 25103363, 30487699, 30683474		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26317998, 29421536		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	24287180, 26121691, 29088792		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	25109285, 31288899		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	30656603		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21397853, 21397863, 23856293, 24324009, 24503539, 24746213, 24909164, 25329972, 26138757, 26317998, 26631723, 27216459, 27686535, 27791271, 27840909, 28197634, 28704962, 28867266, 29243781, 29263907, 29466723, 29683756, 30917505, 31108370, 31188638		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30695683, 31677030		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26141949, 29323702, 29374515, 29713184		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31292999		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	31292999	Associate	★☆☆☆☆ Found in Text Mining only
Memory dysfunction	Memory Disorders	BEFREE	28236057		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	26275361, 28985579, 30656603, 30917505	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	27000941, 28437863, 28527050, 29466723, 30132870		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	21856199, 22562958, 25284742, 30510203, 30917505, 31464387		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	29421536		★☆☆☆☆ Found in Text Mining only
MITOCHONDRIAL COMPLEX I DEFICIENCY	Mitochondrial Complex Deficiency	BEFREE	27126960		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	23046812, 23598413, 23868064, 24324009, 25522270, 27501149, 31037127, 31188638, 32104538, 32863233, 35297042, 35832490, 36871142, 36964505, 37447299, 37795870	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	23108666	Stimulate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	28387563		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	30656603, 38548246	Inhibit	★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	29802856		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	CTD_human_DG	21472714		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mouth Neoplasms	Mouth neoplasm	Pubtator	23800187	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Movement Disorders	Movement Disorders	BEFREE	29081897		★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement disorder	Pubtator	29081897	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	30455381		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	31610192		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	27420645		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	27078640, 27613967, 28302481, 29444200, 30227330, 30485429, 30552292, 31298401		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	27128560, 28500761, 30042676, 30091830, 30485429		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	36991356	Associate	★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	29512306		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20129246, 21358671, 22016654, 22589271, 23272146, 23842789, 24287180, 24324009, 24503539, 24746213, 24909164, 25305228, 25562154, 26141949, 26317998, 26631723, 26785117, 26935174, 27216459, 28338198, 28347248, 28423723, 28512002, 28536275, 28604662, 28634345, 28704962, 28867266, 28947845, 29108235, 29243781, 29466723, 29564694, 29650970, 29683756, 29713184, 29930768, 30464504, 30487699, 31185214		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	30548662, 30588609, 30674870		★☆☆☆☆ Found in Text Mining only
Neurocognitive Disorders	Neurocognitive Disorders	BEFREE	31652451		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	27686535, 28449871, 28634345, 29324783, 31545894, 31740222, 31780922		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28437863, 29581157, 29727630, 30056271, 30525304, 30848932, 30868489, 31160717		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27501149, 28197634, 28947845, 29103158, 29713184		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	29224910		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	21856199, 27000941, 28375738, 28808064, 29220206, 29634313, 30510203, 31302001, 31318577, 31464387, 31522568		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	23956348		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	33185172, 35409099	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ophthalmoplegia Chronic Progressive External	Progressive external ophthalmoplegia	Pubtator	23046812	Associate	★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	27890624, 31037127, 31173361, 31269804		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	33062145, 34646424	Associate	★☆☆☆☆ Found in Text Mining only
Osteogenesis Imperfecta	Osteogenesis imperfecta	Pubtator	32141579	Associate	★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	36012382	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28911171, 28914882		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	28911171, 29512306		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	33662874	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	27216459		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	27216459, 27277143, 31113446, 31547300		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31113446, 31723239, 32495859	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32541517	Inhibit	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25103363, 28867266, 29713184, 30487699, 30683474		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	25755250		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	26121130	Inhibit	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30487699, 36200682	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	25149217, 27053302, 28369333, 28673739, 29567426, 29896416, 31004314		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	28673739		★☆☆☆☆ Found in Text Mining only
Plexiform leiomyoma	Plexiform leiomyoma	GWASCAT_DG	30194396, 31649266		★☆☆☆☆ Found in Text Mining only
Porphyria Variegate	Variegate porphyria	Pubtator	20331452	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26317998, 29421536		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	26317998		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33282964	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	25284742		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	33143333, 35042949	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	27522058, 27815257, 28258190, 28385812, 31011489, 31085231		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	30095923		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29713184		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	28465484, 29197622, 29689547, 29915018, 30250024		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	29363727, 30171880		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	30572719		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	28459202	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	25404738, 29869623, 31201798, 31641228		★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	29072685	Inhibit	★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	29549422	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	30779316		★☆☆☆☆ Found in Text Mining only
SPHEROCYTOSIS, TYPE 1 (disorder)	Spherocytosis	BEFREE	31044629		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CTD_human_DG	21472714		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	28197634, 31055111		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29243781		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22674009, 23475622, 23800187, 26785117, 40009568	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	25503141, 26785117		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	29444200		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	30411306		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	21856199, 28808064, 29581157		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	24287180, 26121691, 29088792		★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28053989, 29872034, 30551525		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	27732568		★☆☆☆☆ Found in Text Mining only
Teratozoospermia	Teratozoospermia	Pubtator	36142505	Inhibit	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	23790338	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	25109285, 31288899		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	25109285, 31288899		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	35136826	Associate	★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	30656603	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	32681437	Associate	★☆☆☆☆ Found in Text Mining only
Tubular Aggregate Myopathy	Tubular Aggregate Myopathy	BEFREE	27420645		★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	GWASCAT_DG	30194396, 31649266		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	37362244	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	35791925	Associate	★☆☆☆☆ Found in Text Mining only
Visceral myopathy familial external ophthalmoplegia	Visceral neuropathy	Pubtator	23868064	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	31037127		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	31037127	Associate	★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	31037127		★☆☆☆☆ Found in Text Mining only