Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	23406
Gene name	Coactosin like F-actin binding protein 1
Gene symbol	COTL1
Synonyms (NCBI Gene)	CLP
Chromosome	16
Chromosome location	16q24.1
Summary	This gene encodes one of the numerous actin-binding proteins which regulate the actin cytoskeleton. This protein binds F-actin, and also interacts with 5-lipoxygenase, which is the first committed enzyme in leukotriene biosynthesis. Although this gene has

156

Show/Hide all (156)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016551	hsa-miR-193b-3p	Proteomics	21512034
MIRT024011	hsa-miR-1-3p	Microarray	18668037
MIRT044527	hsa-miR-320a	CLASH	23622248
MIRT043571	hsa-miR-331-3p	CLASH	23622248
MIRT037467	hsa-miR-744-5p	CLASH	23622248
MIRT904787	hsa-miR-1200	CLIP-seq
MIRT904788	hsa-miR-1207-5p	CLIP-seq
MIRT904789	hsa-miR-1225-3p	CLIP-seq
MIRT904790	hsa-miR-1233	CLIP-seq
MIRT904791	hsa-miR-1236	CLIP-seq
MIRT904792	hsa-miR-1285	CLIP-seq
MIRT904793	hsa-miR-2116	CLIP-seq
MIRT904794	hsa-miR-22	CLIP-seq
MIRT904795	hsa-miR-24	CLIP-seq
MIRT904796	hsa-miR-2467-3p	CLIP-seq
MIRT904797	hsa-miR-3119	CLIP-seq
MIRT904798	hsa-miR-3121-5p	CLIP-seq
MIRT904799	hsa-miR-3136-3p	CLIP-seq
MIRT904800	hsa-miR-3140-3p	CLIP-seq
MIRT904801	hsa-miR-3140-5p	CLIP-seq
MIRT904802	hsa-miR-3157-3p	CLIP-seq
MIRT904803	hsa-miR-3170	CLIP-seq
MIRT904804	hsa-miR-3187-5p	CLIP-seq
MIRT904805	hsa-miR-3200-3p	CLIP-seq
MIRT904806	hsa-miR-323b-3p	CLIP-seq
MIRT904807	hsa-miR-326	CLIP-seq
MIRT904808	hsa-miR-330-5p	CLIP-seq
MIRT904809	hsa-miR-342-5p	CLIP-seq
MIRT904810	hsa-miR-3613-3p	CLIP-seq
MIRT904811	hsa-miR-3616-5p	CLIP-seq
MIRT904812	hsa-miR-3620	CLIP-seq
MIRT904813	hsa-miR-3647-5p	CLIP-seq
MIRT904814	hsa-miR-3662	CLIP-seq
MIRT904815	hsa-miR-3678-3p	CLIP-seq
MIRT904816	hsa-miR-378g	CLIP-seq
MIRT904817	hsa-miR-3941	CLIP-seq
MIRT904818	hsa-miR-4260	CLIP-seq
MIRT904819	hsa-miR-4267	CLIP-seq
MIRT904820	hsa-miR-4286	CLIP-seq
MIRT904821	hsa-miR-4292	CLIP-seq
MIRT904822	hsa-miR-4300	CLIP-seq
MIRT904823	hsa-miR-4303	CLIP-seq
MIRT904824	hsa-miR-4437	CLIP-seq
MIRT904825	hsa-miR-4438	CLIP-seq
MIRT904826	hsa-miR-4475	CLIP-seq
MIRT904827	hsa-miR-4486	CLIP-seq
MIRT904828	hsa-miR-4502	CLIP-seq
MIRT904829	hsa-miR-4514	CLIP-seq
MIRT904830	hsa-miR-4537	CLIP-seq
MIRT904831	hsa-miR-4651	CLIP-seq
MIRT904832	hsa-miR-466	CLIP-seq
MIRT904833	hsa-miR-4664-5p	CLIP-seq
MIRT904834	hsa-miR-4672	CLIP-seq
MIRT904835	hsa-miR-4674	CLIP-seq
MIRT904836	hsa-miR-4677-3p	CLIP-seq
MIRT904837	hsa-miR-4677-5p	CLIP-seq
MIRT904838	hsa-miR-4692	CLIP-seq
MIRT904839	hsa-miR-4698	CLIP-seq
MIRT904840	hsa-miR-4711-5p	CLIP-seq
MIRT904841	hsa-miR-4713-3p	CLIP-seq
MIRT904842	hsa-miR-4733-5p	CLIP-seq
MIRT904843	hsa-miR-4736	CLIP-seq
MIRT904844	hsa-miR-4756-3p	CLIP-seq
MIRT904845	hsa-miR-4763-3p	CLIP-seq
MIRT904846	hsa-miR-4773	CLIP-seq
MIRT904847	hsa-miR-4778-3p	CLIP-seq
MIRT904848	hsa-miR-4795-5p	CLIP-seq
MIRT904849	hsa-miR-516a-3p	CLIP-seq
MIRT904850	hsa-miR-573	CLIP-seq
MIRT904851	hsa-miR-608	CLIP-seq
MIRT904852	hsa-miR-612	CLIP-seq
MIRT904853	hsa-miR-622	CLIP-seq
MIRT904854	hsa-miR-874	CLIP-seq
MIRT904855	hsa-miR-920	CLIP-seq
MIRT904856	hsa-miR-938	CLIP-seq
MIRT904857	hsa-miR-940	CLIP-seq
MIRT1547442	hsa-miR-147	CLIP-seq
MIRT1547443	hsa-miR-644	CLIP-seq
MIRT1920098	hsa-miR-1273f	CLIP-seq
MIRT1920099	hsa-miR-1294	CLIP-seq
MIRT1920100	hsa-miR-1299	CLIP-seq
MIRT1920101	hsa-miR-143	CLIP-seq
MIRT1920102	hsa-miR-1538	CLIP-seq
MIRT1920103	hsa-miR-3978	CLIP-seq
MIRT1920104	hsa-miR-4470	CLIP-seq
MIRT1920105	hsa-miR-4708-5p	CLIP-seq
MIRT1920106	hsa-miR-4745-3p	CLIP-seq
MIRT1920107	hsa-miR-4747-3p	CLIP-seq
MIRT1920108	hsa-miR-4770	CLIP-seq
MIRT1920109	hsa-miR-760	CLIP-seq
MIRT1920110	hsa-miR-875-3p	CLIP-seq
MIRT1968330	hsa-miR-135a	CLIP-seq
MIRT1968331	hsa-miR-135b	CLIP-seq
MIRT1968332	hsa-miR-1908	CLIP-seq
MIRT1968333	hsa-miR-325	CLIP-seq
MIRT1968334	hsa-miR-4287	CLIP-seq
MIRT904821	hsa-miR-4292	CLIP-seq
MIRT1968335	hsa-miR-4417	CLIP-seq
MIRT1968336	hsa-miR-4469	CLIP-seq
MIRT1968337	hsa-miR-4649-3p	CLIP-seq
MIRT904831	hsa-miR-4651	CLIP-seq
MIRT1968338	hsa-miR-4675	CLIP-seq
MIRT1968339	hsa-miR-4685-3p	CLIP-seq
MIRT1968340	hsa-miR-4741	CLIP-seq
MIRT1968341	hsa-miR-4767	CLIP-seq
MIRT904851	hsa-miR-608	CLIP-seq
MIRT1968342	hsa-miR-663	CLIP-seq
MIRT1547442	hsa-miR-147	CLIP-seq
MIRT1547443	hsa-miR-644	CLIP-seq
MIRT1547442	hsa-miR-147	CLIP-seq
MIRT1547443	hsa-miR-644	CLIP-seq
MIRT2507633	hsa-miR-1178	CLIP-seq
MIRT904787	hsa-miR-1200	CLIP-seq
MIRT904789	hsa-miR-1225-3p	CLIP-seq
MIRT904790	hsa-miR-1233	CLIP-seq
MIRT2507634	hsa-miR-1915	CLIP-seq
MIRT904797	hsa-miR-3119	CLIP-seq
MIRT904800	hsa-miR-3140-3p	CLIP-seq
MIRT904801	hsa-miR-3140-5p	CLIP-seq
MIRT2507635	hsa-miR-3158-3p	CLIP-seq
MIRT904803	hsa-miR-3170	CLIP-seq
MIRT904809	hsa-miR-342-5p	CLIP-seq
MIRT904817	hsa-miR-3941	CLIP-seq
MIRT904818	hsa-miR-4260	CLIP-seq
MIRT904819	hsa-miR-4267	CLIP-seq
MIRT904825	hsa-miR-4438	CLIP-seq
MIRT904826	hsa-miR-4475	CLIP-seq
MIRT904831	hsa-miR-4651	CLIP-seq
MIRT904832	hsa-miR-466	CLIP-seq
MIRT904833	hsa-miR-4664-5p	CLIP-seq
MIRT904834	hsa-miR-4672	CLIP-seq
MIRT904836	hsa-miR-4677-3p	CLIP-seq
MIRT2507636	hsa-miR-4685-5p	CLIP-seq
MIRT904841	hsa-miR-4713-3p	CLIP-seq
MIRT904849	hsa-miR-516a-3p	CLIP-seq
MIRT904851	hsa-miR-608	CLIP-seq
MIRT2507633	hsa-miR-1178	CLIP-seq
MIRT904789	hsa-miR-1225-3p	CLIP-seq
MIRT904790	hsa-miR-1233	CLIP-seq
MIRT2507634	hsa-miR-1915	CLIP-seq
MIRT904797	hsa-miR-3119	CLIP-seq
MIRT904799	hsa-miR-3136-3p	CLIP-seq
MIRT904800	hsa-miR-3140-3p	CLIP-seq
MIRT2507635	hsa-miR-3158-3p	CLIP-seq
MIRT904803	hsa-miR-3170	CLIP-seq
MIRT904809	hsa-miR-342-5p	CLIP-seq
MIRT2678499	hsa-miR-3960	CLIP-seq
MIRT904818	hsa-miR-4260	CLIP-seq
MIRT904825	hsa-miR-4438	CLIP-seq
MIRT2678500	hsa-miR-4479	CLIP-seq
MIRT904831	hsa-miR-4651	CLIP-seq
MIRT904833	hsa-miR-4664-5p	CLIP-seq
MIRT2678501	hsa-miR-4665-3p	CLIP-seq
MIRT904836	hsa-miR-4677-3p	CLIP-seq
MIRT2507636	hsa-miR-4685-5p	CLIP-seq
MIRT904851	hsa-miR-608	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003779	Function	Actin binding	IDA	11583571
GO:0003779	Function	Actin binding	IEA
GO:0005515	Function	Protein binding	IPI	11297527, 16924104, 21044950, 25416956
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005884	Component	Actin filament	IBA
GO:0019899	Function	Enzyme binding	IEA
GO:0019899	Function	Enzyme binding	IPI	11297527
GO:0030427	Component	Site of polarized growth	IBA
GO:0030833	Process	Regulation of actin filament polymerization	IBA
GO:0030864	Component	Cortical actin cytoskeleton	IBA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0050832	Process	Defense response to fungus	IEA
GO:0051015	Function	Actin filament binding	IBA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

MIM	HGNC	e!Ensembl
606748	18304	ENSG00000103187

Q14019

Protein name

Coactosin-like protein

Protein function

Binds to F-actin in a calcium-independent manner. Has no direct effect on actin depolymerization. Acts as a chaperone for ALOX5 (5LO), influencing both its stability and activity in leukotrienes synthesis. {ECO:0000269|PubMed:11583571, ECO:00002

PDB

1T2L , 1T3X , 1T3Y , 1TMW , 1VFQ , 1WNJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00241	Cofilin_ADF	10 → 128	Cofilin/tropomyosin-type actin-binding protein	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed with highest levels in placenta, lung, kidney and peripheral blood leukocytes and lower levels in brain, liver and pancreas. {ECO:0000269|PubMed:11583571}.

Sequence

MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFA
FVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKEL
EEDFIKSELKKAGGANYDAQTE

Sequence length

142

Interactions

View interactions

	Reactome
			Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (42)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	29954413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	29929532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	19307756, 33430905	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	39293435	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	19307756, 27696572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	19307756	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	20562527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28925397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Soft Palate	Cleft Soft Palate	BEFREE	28393073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28437455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	17786325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	40082818	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental absence of tooth	Anodontia	BEFREE	22612415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	GWASCAT_DG	26220383		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	BEFREE	30269613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	11870627	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypodontia	Hypodontia	BEFREE	21248356, 22612415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	31231966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	19307756	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	19307756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	20562527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28925397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11870627, 28925397, 29338031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	17786325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	20562527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	20562527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	20562527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	BEFREE	29460382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28925397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21047053, 22373659, 27893417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	27919438	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral cleft	Oral cleft	BEFREE	11754469, 31226652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	17786325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	11870627	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pierre Robin Syndrome	Pierre-Robin Syndrome	BEFREE	29125932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	19307756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	35681439	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	25559266, 25981615, 28167245, 28246552, 28715505, 28910403, 29095202, 29338031, 29500815, 29535830, 29914696, 29937001, 30690081, 30918470, 30961427, 31049763, 31223614, 31231384 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	21047053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Submucous cleft palate	Submucosal cleft palate	BEFREE	24437586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31669320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	15516164, 29742363, 31226652, 31795734		★★★★★ ★☆☆☆☆ Found in Text Mining only

COTL1 (coactosin like F-actin binding protein 1)