Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	23368
Gene name	Protein phosphatase 1 regulatory subunit 13B
Gene symbol	PPP1R13B
Synonyms (NCBI Gene)	ASPP1p53BP2-likep85
Chromosome	14
Chromosome location	14q32.33
Summary	This gene encodes a member of the ASPP (apoptosis-stimulating protein of p53) family of p53 interacting proteins. The protein contains four ankyrin repeats and an SH3 domain involved in protein-protein interactions. ASPP proteins are required for the indu

247

Show/Hide all (247)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006485	hsa-miR-29a-3p	Luciferase reporter assayWestern blot	19079265
MIRT006485	hsa-miR-29a-3p	Luciferase reporter assayWestern blot	19079265
MIRT006486	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	19079265
MIRT006486	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	19079265
MIRT006487	hsa-miR-29c-3p	Luciferase reporter assayWestern blot	19079265
MIRT006485	hsa-miR-29a-3p	Luciferase reporter assayWestern blot	19079265
MIRT006485	hsa-miR-29a-3p	Luciferase reporter assayWestern blot	19079265
MIRT006485	hsa-miR-29a-3p	Luciferase reporter assayWestern blot	19079265
MIRT006485	hsa-miR-29a-3p	Luciferase reporter assayWestern blot	19079265
MIRT006486	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	19079265
MIRT006486	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	19079265
MIRT006487	hsa-miR-29c-3p	Luciferase reporter assayWestern blot	19079265
MIRT006485	hsa-miR-29a-3p	Luciferase reporter assayWestern blot	19079265
MIRT006485	hsa-miR-29a-3p	Luciferase reporter assayWestern blot	19079265
MIRT047417	hsa-miR-10b-5p	CLASH	23622248
MIRT045828	hsa-miR-138-5p	CLASH	23622248
MIRT040984	hsa-miR-505-3p	CLASH	23622248
MIRT039385	hsa-miR-421	CLASH	23622248
MIRT039041	hsa-miR-766-3p	CLASH	23622248
MIRT038764	hsa-miR-93-3p	CLASH	23622248
MIRT1255823	hsa-miR-1253	CLIP-seq
MIRT1255824	hsa-miR-1285	CLIP-seq
MIRT1255825	hsa-miR-1302	CLIP-seq
MIRT1255826	hsa-miR-1304	CLIP-seq
MIRT1255827	hsa-miR-139-5p	CLIP-seq
MIRT1255828	hsa-miR-141	CLIP-seq
MIRT1255829	hsa-miR-147	CLIP-seq
MIRT1255830	hsa-miR-148a	CLIP-seq
MIRT1255831	hsa-miR-148b	CLIP-seq
MIRT1255832	hsa-miR-152	CLIP-seq
MIRT1255833	hsa-miR-197	CLIP-seq
MIRT1255834	hsa-miR-200a	CLIP-seq
MIRT1255835	hsa-miR-214	CLIP-seq
MIRT1255836	hsa-miR-2467-5p	CLIP-seq
MIRT1255837	hsa-miR-2861	CLIP-seq
MIRT1255838	hsa-miR-3121-5p	CLIP-seq
MIRT1255839	hsa-miR-3150b-3p	CLIP-seq
MIRT1255840	hsa-miR-3179	CLIP-seq
MIRT1255841	hsa-miR-3185	CLIP-seq
MIRT1255842	hsa-miR-3187-5p	CLIP-seq
MIRT1255843	hsa-miR-3188	CLIP-seq
MIRT1255844	hsa-miR-3607-5p	CLIP-seq
MIRT1255845	hsa-miR-3619-5p	CLIP-seq
MIRT1255846	hsa-miR-3654	CLIP-seq
MIRT1255847	hsa-miR-3911	CLIP-seq
MIRT1255848	hsa-miR-3941	CLIP-seq
MIRT1255849	hsa-miR-3975	CLIP-seq
MIRT1255850	hsa-miR-412	CLIP-seq
MIRT1255851	hsa-miR-4276	CLIP-seq
MIRT1255852	hsa-miR-4282	CLIP-seq
MIRT1255853	hsa-miR-4291	CLIP-seq
MIRT1255854	hsa-miR-4298	CLIP-seq
MIRT1255855	hsa-miR-4312	CLIP-seq
MIRT1255856	hsa-miR-4434	CLIP-seq
MIRT1255857	hsa-miR-4448	CLIP-seq
MIRT1255858	hsa-miR-4505	CLIP-seq
MIRT1255859	hsa-miR-4516	CLIP-seq
MIRT1255860	hsa-miR-4638-3p	CLIP-seq
MIRT1255861	hsa-miR-4648	CLIP-seq
MIRT1255862	hsa-miR-4654	CLIP-seq
MIRT1255863	hsa-miR-466	CLIP-seq
MIRT1255864	hsa-miR-4672	CLIP-seq
MIRT1255865	hsa-miR-4697-3p	CLIP-seq
MIRT1255866	hsa-miR-4711-5p	CLIP-seq
MIRT1255867	hsa-miR-4747-5p	CLIP-seq
MIRT1255868	hsa-miR-4761-5p	CLIP-seq
MIRT1255869	hsa-miR-4769-5p	CLIP-seq
MIRT1255870	hsa-miR-4784	CLIP-seq
MIRT1255871	hsa-miR-4790-3p	CLIP-seq
MIRT1255872	hsa-miR-4797-5p	CLIP-seq
MIRT1255873	hsa-miR-485-5p	CLIP-seq
MIRT1255874	hsa-miR-503	CLIP-seq
MIRT1255875	hsa-miR-512-3p	CLIP-seq
MIRT1255876	hsa-miR-513a-3p	CLIP-seq
MIRT1255877	hsa-miR-548v	CLIP-seq
MIRT1255878	hsa-miR-587	CLIP-seq
MIRT1255879	hsa-miR-595	CLIP-seq
MIRT1255880	hsa-miR-601	CLIP-seq
MIRT1255881	hsa-miR-603	CLIP-seq
MIRT1255882	hsa-miR-612	CLIP-seq
MIRT1255883	hsa-miR-644	CLIP-seq
MIRT1255884	hsa-miR-661	CLIP-seq
MIRT1255885	hsa-miR-761	CLIP-seq
MIRT1255886	hsa-miR-765	CLIP-seq
MIRT1255887	hsa-miR-9	CLIP-seq
MIRT1255888	hsa-miR-922	CLIP-seq
MIRT2075384	hsa-miR-1184	CLIP-seq
MIRT2075385	hsa-miR-1207-5p	CLIP-seq
MIRT2075386	hsa-miR-1255a	CLIP-seq
MIRT2075387	hsa-miR-1255b	CLIP-seq
MIRT2075388	hsa-miR-128	CLIP-seq
MIRT2075389	hsa-miR-1301	CLIP-seq
MIRT2075390	hsa-miR-1343	CLIP-seq
MIRT2075391	hsa-miR-136	CLIP-seq
MIRT2075392	hsa-miR-150	CLIP-seq
MIRT2075393	hsa-miR-182	CLIP-seq
MIRT2075394	hsa-miR-1910	CLIP-seq
MIRT2075395	hsa-miR-22	CLIP-seq
MIRT1255836	hsa-miR-2467-5p	CLIP-seq
MIRT1255837	hsa-miR-2861	CLIP-seq
MIRT2075396	hsa-miR-3074-5p	CLIP-seq
MIRT2075397	hsa-miR-3124-3p	CLIP-seq
MIRT2075398	hsa-miR-3127-5p	CLIP-seq
MIRT2075399	hsa-miR-3141	CLIP-seq
MIRT2075400	hsa-miR-3148	CLIP-seq
MIRT1255843	hsa-miR-3188	CLIP-seq
MIRT2075401	hsa-miR-3189-3p	CLIP-seq
MIRT2075402	hsa-miR-345	CLIP-seq
MIRT2075403	hsa-miR-3612	CLIP-seq
MIRT2075404	hsa-miR-361-3p	CLIP-seq
MIRT2075405	hsa-miR-3659	CLIP-seq
MIRT2075406	hsa-miR-3690	CLIP-seq
MIRT2075407	hsa-miR-3960	CLIP-seq
MIRT1255849	hsa-miR-3975	CLIP-seq
MIRT2075408	hsa-miR-4254	CLIP-seq
MIRT2075409	hsa-miR-4268	CLIP-seq
MIRT2075410	hsa-miR-4270	CLIP-seq
MIRT2075411	hsa-miR-432	CLIP-seq
MIRT2075412	hsa-miR-4323	CLIP-seq
MIRT2075413	hsa-miR-4441	CLIP-seq
MIRT2075414	hsa-miR-4443	CLIP-seq
MIRT1255857	hsa-miR-4448	CLIP-seq
MIRT2075415	hsa-miR-4470	CLIP-seq
MIRT2075416	hsa-miR-4471	CLIP-seq
MIRT2075417	hsa-miR-4479	CLIP-seq
MIRT2075418	hsa-miR-455-3p	CLIP-seq
MIRT2075419	hsa-miR-4634	CLIP-seq
MIRT2075420	hsa-miR-4650-5p	CLIP-seq
MIRT2075421	hsa-miR-4658	CLIP-seq
MIRT2075422	hsa-miR-4660	CLIP-seq
MIRT2075423	hsa-miR-4669	CLIP-seq
MIRT2075424	hsa-miR-4680-3p	CLIP-seq
MIRT2075425	hsa-miR-4690-5p	CLIP-seq
MIRT2075426	hsa-miR-4691-3p	CLIP-seq
MIRT2075427	hsa-miR-4713-5p	CLIP-seq
MIRT2075428	hsa-miR-4731-5p	CLIP-seq
MIRT1255868	hsa-miR-4761-5p	CLIP-seq
MIRT2075429	hsa-miR-4763-3p	CLIP-seq
MIRT1255873	hsa-miR-485-5p	CLIP-seq
MIRT2075430	hsa-miR-486-3p	CLIP-seq
MIRT2075431	hsa-miR-5047	CLIP-seq
MIRT1255875	hsa-miR-512-3p	CLIP-seq
MIRT2075432	hsa-miR-532-3p	CLIP-seq
MIRT2075433	hsa-miR-539	CLIP-seq
MIRT2075434	hsa-miR-548k	CLIP-seq
MIRT2075435	hsa-miR-574-5p	CLIP-seq
MIRT1255879	hsa-miR-595	CLIP-seq
MIRT2075436	hsa-miR-650	CLIP-seq
MIRT2075437	hsa-miR-875-3p	CLIP-seq
MIRT2301985	hsa-miR-106a	CLIP-seq
MIRT2301986	hsa-miR-106b	CLIP-seq
MIRT2075384	hsa-miR-1184	CLIP-seq
MIRT2301987	hsa-miR-1225-5p	CLIP-seq
MIRT2301988	hsa-miR-1283	CLIP-seq
MIRT1255824	hsa-miR-1285	CLIP-seq
MIRT2075389	hsa-miR-1301	CLIP-seq
MIRT2075390	hsa-miR-1343	CLIP-seq
MIRT1255827	hsa-miR-139-5p	CLIP-seq
MIRT1255830	hsa-miR-148a	CLIP-seq
MIRT1255831	hsa-miR-148b	CLIP-seq
MIRT2075392	hsa-miR-150	CLIP-seq
MIRT1255832	hsa-miR-152	CLIP-seq
MIRT2301989	hsa-miR-1587	CLIP-seq
MIRT2301990	hsa-miR-17	CLIP-seq
MIRT2301991	hsa-miR-1913	CLIP-seq
MIRT2301992	hsa-miR-1914	CLIP-seq
MIRT1255833	hsa-miR-197	CLIP-seq
MIRT2301993	hsa-miR-20a	CLIP-seq
MIRT2301994	hsa-miR-20b	CLIP-seq
MIRT1255835	hsa-miR-214	CLIP-seq
MIRT2075395	hsa-miR-22	CLIP-seq
MIRT2075396	hsa-miR-3074-5p	CLIP-seq
MIRT2301995	hsa-miR-3115	CLIP-seq
MIRT2075397	hsa-miR-3124-3p	CLIP-seq
MIRT2075400	hsa-miR-3148	CLIP-seq
MIRT1255842	hsa-miR-3187-5p	CLIP-seq
MIRT2301996	hsa-miR-3189-5p	CLIP-seq
MIRT2301997	hsa-miR-3199	CLIP-seq
MIRT2301998	hsa-miR-324-3p	CLIP-seq
MIRT2301999	hsa-miR-329	CLIP-seq
MIRT2302000	hsa-miR-3609	CLIP-seq
MIRT2075403	hsa-miR-3612	CLIP-seq
MIRT1255845	hsa-miR-3619-5p	CLIP-seq
MIRT2302001	hsa-miR-3622a-3p	CLIP-seq
MIRT2302002	hsa-miR-3622b-3p	CLIP-seq
MIRT2302003	hsa-miR-362-3p	CLIP-seq
MIRT2075406	hsa-miR-3690	CLIP-seq
MIRT2302004	hsa-miR-378g	CLIP-seq
MIRT1255848	hsa-miR-3941	CLIP-seq
MIRT2302005	hsa-miR-3944-3p	CLIP-seq
MIRT1255850	hsa-miR-412	CLIP-seq
MIRT2075408	hsa-miR-4254	CLIP-seq
MIRT2302006	hsa-miR-4267	CLIP-seq
MIRT2075409	hsa-miR-4268	CLIP-seq
MIRT1255853	hsa-miR-4291	CLIP-seq
MIRT1255856	hsa-miR-4434	CLIP-seq
MIRT1255857	hsa-miR-4448	CLIP-seq
MIRT2302007	hsa-miR-4468	CLIP-seq
MIRT2075415	hsa-miR-4470	CLIP-seq
MIRT2302008	hsa-miR-4481	CLIP-seq
MIRT2302009	hsa-miR-4486	CLIP-seq
MIRT2302010	hsa-miR-4492	CLIP-seq
MIRT2302011	hsa-miR-4498	CLIP-seq
MIRT2302012	hsa-miR-4506	CLIP-seq
MIRT2302013	hsa-miR-4512	CLIP-seq
MIRT1255859	hsa-miR-4516	CLIP-seq
MIRT2302014	hsa-miR-4531	CLIP-seq
MIRT2302015	hsa-miR-4655-5p	CLIP-seq
MIRT2302016	hsa-miR-4656	CLIP-seq
MIRT2302017	hsa-miR-4659a-3p	CLIP-seq
MIRT2302018	hsa-miR-4659b-3p	CLIP-seq
MIRT2075422	hsa-miR-4660	CLIP-seq
MIRT2302019	hsa-miR-4675	CLIP-seq
MIRT1255865	hsa-miR-4697-3p	CLIP-seq
MIRT2075427	hsa-miR-4713-5p	CLIP-seq
MIRT2302020	hsa-miR-4741	CLIP-seq
MIRT2302021	hsa-miR-4745-5p	CLIP-seq
MIRT2302022	hsa-miR-4758-3p	CLIP-seq
MIRT1255868	hsa-miR-4761-5p	CLIP-seq
MIRT2302023	hsa-miR-4787-5p	CLIP-seq
MIRT2302024	hsa-miR-4796-3p	CLIP-seq
MIRT1255874	hsa-miR-503	CLIP-seq
MIRT2075431	hsa-miR-5047	CLIP-seq
MIRT1255875	hsa-miR-512-3p	CLIP-seq
MIRT2302025	hsa-miR-519d	CLIP-seq
MIRT2075432	hsa-miR-532-3p	CLIP-seq
MIRT2075433	hsa-miR-539	CLIP-seq
MIRT2302026	hsa-miR-548ah	CLIP-seq
MIRT2075434	hsa-miR-548k	CLIP-seq
MIRT1255877	hsa-miR-548v	CLIP-seq
MIRT2302027	hsa-miR-569	CLIP-seq
MIRT2302028	hsa-miR-570	CLIP-seq
MIRT1255881	hsa-miR-603	CLIP-seq
MIRT1255882	hsa-miR-612	CLIP-seq
MIRT2302029	hsa-miR-619	CLIP-seq
MIRT2302030	hsa-miR-624	CLIP-seq
MIRT2075436	hsa-miR-650	CLIP-seq
MIRT2302031	hsa-miR-759	CLIP-seq
MIRT1255885	hsa-miR-761	CLIP-seq
MIRT2302032	hsa-miR-762	CLIP-seq
MIRT2075437	hsa-miR-875-3p	CLIP-seq
MIRT2302033	hsa-miR-885-3p	CLIP-seq
MIRT1255888	hsa-miR-922	CLIP-seq
MIRT2302034	hsa-miR-93	CLIP-seq
MIRT2392918	hsa-miR-3120-5p	CLIP-seq
MIRT2075415	hsa-miR-4470	CLIP-seq
MIRT2075427	hsa-miR-4713-5p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
E2F1	Activation	15706352;21479363

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002039	Function	P53 binding	IBA
GO:0002039	Function	P53 binding	IEA
GO:0005515	Function	Protein binding	IPI	11684014, 14729977, 15231748, 17043677, 21513714, 21998301, 22321011, 24366813, 25416956, 28330616, 28514442, 31413325, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	11684014
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	15782125
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0006915	Process	Apoptotic process	IEA
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0045786	Process	Negative regulation of cell cycle	IEA
GO:0045786	Process	Negative regulation of cell cycle	TAS	14729977
GO:0072332	Process	Intrinsic apoptotic signaling pathway by p53 class mediator	IDA	11684014
GO:0072332	Process	Intrinsic apoptotic signaling pathway by p53 class mediator	IEA

MIM	HGNC	e!Ensembl
606455	14950	ENSG00000088808

Q96KQ4

Protein name

Apoptosis-stimulating of p53 protein 1 (Protein phosphatase 1 regulatory subunit 13B)

Protein function

Regulator that plays a central role in regulation of apoptosis via its interaction with p53/TP53 (PubMed:11684014, PubMed:12524540). Regulates TP53 by enhancing the DNA binding and transactivation function of TP53 on the promoters of proapoptoti

PDB

6HL5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00023	Ank	920 → 952	Ankyrin repeat	Repeat
PF00023	Ank	953 → 985	Ankyrin repeat	Repeat
PF00018	SH3_1	1025 → 1073	SH3 domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Reduced expression in breast carcinomas expressing a wild-type TP53 protein. {ECO:0000269|PubMed:11684014}.

Sequence

MMPMILTVFLSNNEQILTEVPITPETTCRDVVEFCKEPGEGSCHLAEVWRGNERPIPFDH
MMYEHLQKWGPRREEVKFFLRHEDSPTENSEQGGRQTQEQRTQRNVINVPGEKRTENGVG
NPRVELTLSELQDMAARQQQQIENQQQMLVAKEQRLHFLKQQERRQQQSISENEKLQKLK
ERVEAQENKLKKIRAMRGQVDYSKIMNGNLSAEIERFSAMFQEKKQEVQTAILRVDQLSQ
QLEDLKKGKLNGFQSYNGKLTGPAAVELKRLYQELQIRNQLNQEQNSKLQQQKELLNKRN
MEVAMMDKRISELRERLYGKKIQLNRVNGTSSPQSPLSTSGRVAAVGPYIQVPSAGSFPV
LGDPIKPQSLSIASNAAHGRSKSANDGNWPTLKQNSSSSVKPVQVAGADWKDPSVEGSVK
QGTVSSQPVPFSALGPTEKPGIEIGKVPPPIPGVGKQLPPSYGTYPSPTPLGPGSTSSLE
RRKEGSLPRPSAGLPSRQRPTLLPATGSTPQPGSSQQIQQRISVPPSPTYPPAGPPAFPA
GDSKPELPLTVAIRPFLADKGSRPQSPRKGPQTVNSSSIYSMYLQQATPPKNYQPAAHSA
LNKSVKAVYGKPVLPSGSTSPSPLPFLHGSLSTGTPQPQPPSESTEKEPEQDGPAAPADG
STVESLPRPLSPTKLTPIVHSPLRYQSDADLEALRRKLANAPRPLKKRSSITEPEGPGGP
NIQKLLYQRFNTLAGGMEGTPFYQPSPSQDFMGTLADVDNGNTNANGNLEELPPAQPTAP
LPAEPAPSSDANDNELPSPEPEELICPQTTHQTAEPAEDNNNNVATVPTTEQIPSPVAEA
PSPGEEQVPPAPLPPASHPPATSTNKRTNLKKPNSERTGHGLRVRFNPLALLLDASLEGE
FDLVQRIIYEVEDPSKPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNAADSDGWTPLHC
AASCNSVHLCKQLVESGAAIFASTISDIETAADKCEEMEEGYIQCSQFLYGVQEKLGVMN
KGVAYALWDYEAQNSDELSFHEGDALTILRRKDESETEWWWARLGDREGYVPKNLLGLYP
RIKPRQRTLA

Sequence length

1090

Interactions

View interactions

	Reactome
			Activation of PUMA and translocation to mitochondria TP53 Regulates Transcription of Genes Involved in Cytochrome C Release TP53 regulates transcription of several additional cell death genes whose specific roles in p53-dependent apoptosis remain uncertain TP53 Regulates Transcription of Death Receptors and Ligands Regulation of TP53 Activity through Association with Co-factors

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (15)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANOREXIA NERVOSA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Childhood-onset schizophrenia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (53)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	16314841, 28580304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	1310887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	16314841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	37354922	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12524540, 16579640, 21479363, 23222510, 28027535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	1310887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Child Development Disorders, Pervasive	Development Disorder	GWASCAT_DG	28540026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	16314841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	21102414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	22623730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	26864651, 7541019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31217502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28656647, 29288416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erythrocytosis familial, 1	Erythrocytosis	BEFREE	19336760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	28103919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gestational trophoblastic disease	Hydatidiform mole	BEFREE	21102414, 31615473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Disease	Gestational trophoblastic disease	Pubtator	21102414, 31615473	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Neoplasms	Gestational Trophoblastic Neoplasms	BEFREE	21102414, 31615473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	18328427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	18328427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	29953879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	29496059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	11986952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform Mole	BEFREE	21102414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform mole	Pubtator	21102414	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	24469048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	38195541	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	28580304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20034025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	11986952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	9538131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	29496059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21479363, 23222510, 28027535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	29288416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	1310887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28012929, 28614092, 31428587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16131837, 23270540, 27827005, 28594407, 28630349, 28743532, 29246942, 29616047, 29731851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26864651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	28223140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	24555840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	9857977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	19286672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	29409973, 30662656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16314841, 16917505, 20034025, 27130196, 27827005, 28656647, 29588411, 9538131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22552744, 24550137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	11440917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	BEFREE	19336760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	16314841, 28580304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28012929, 28614092, 31428587		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30908929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	29288416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29288416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	28540026		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

PPP1R13B (protein phosphatase 1 regulatory subunit 13B)