Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	23338
Gene name	Jade family PHD finger 2
Gene symbol	JADE2
Synonyms (NCBI Gene)	JADE-2PHF15
Chromosome	5
Chromosome location	5q31.1

Show/Hide all (59)

miRTarBase ID	miRNA	Experiments	Reference
MIRT441674	hsa-miR-4761-3p	PAR-CLIP	23708386
MIRT441673	hsa-miR-663b	PAR-CLIP	23708386
MIRT441672	hsa-miR-4435	PAR-CLIP	23708386
MIRT441671	hsa-miR-7108-5p	PAR-CLIP	23708386
MIRT487361	hsa-miR-3714	PAR-CLIP	23592263
MIRT487360	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT487359	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT487358	hsa-miR-940	PAR-CLIP	23592263
MIRT487357	hsa-miR-1286	PAR-CLIP	23592263
MIRT487356	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT487355	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT487354	hsa-miR-4736	PAR-CLIP	23592263
MIRT487353	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT487351	hsa-miR-663a	PAR-CLIP	23592263
MIRT487352	hsa-miR-6787-5p	PAR-CLIP	23592263
MIRT487350	hsa-miR-4525	PAR-CLIP	23592263
MIRT487349	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT487348	hsa-miR-6795-5p	PAR-CLIP	23592263
MIRT487347	hsa-miR-6887-5p	PAR-CLIP	23592263
MIRT487346	hsa-miR-7150	PAR-CLIP	23592263
MIRT487345	hsa-miR-4655-5p	PAR-CLIP	23592263
MIRT441674	hsa-miR-4761-3p	PAR-CLIP	22100165
MIRT441673	hsa-miR-663b	PAR-CLIP	22100165
MIRT441672	hsa-miR-4435	PAR-CLIP	22100165
MIRT441671	hsa-miR-7108-5p	PAR-CLIP	22100165
MIRT441674	hsa-miR-4761-3p	PAR-CLIP	22100165
MIRT441673	hsa-miR-663b	PAR-CLIP	22100165
MIRT441672	hsa-miR-4435	PAR-CLIP	22100165
MIRT441671	hsa-miR-7108-5p	PAR-CLIP	22100165
MIRT755003	hsa-miR-3714	PAR-CLIP	26701625
MIRT754827	hsa-miR-4761-3p	PAR-CLIP	23708386
MIRT754828	hsa-miR-663b	PAR-CLIP	23708386
MIRT754829	hsa-miR-4435	PAR-CLIP	23708386
MIRT754830	hsa-miR-7108-5p	PAR-CLIP	23708386
MIRT755003	hsa-miR-3714	PAR-CLIP	23592263
MIRT755004	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT755005	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT755006	hsa-miR-940	PAR-CLIP	23592263
MIRT755007	hsa-miR-1286	PAR-CLIP	23592263
MIRT755008	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT755009	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT755010	hsa-miR-4736	PAR-CLIP	23592263
MIRT755011	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT755012	hsa-miR-663a	PAR-CLIP	23592263
MIRT755013	hsa-miR-6787-5p	PAR-CLIP	23592263
MIRT755014	hsa-miR-4525	PAR-CLIP	23592263
MIRT755015	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT755016	hsa-miR-6795-5p	PAR-CLIP	23592263
MIRT755017	hsa-miR-6887-5p	PAR-CLIP	23592263
MIRT755018	hsa-miR-7150	PAR-CLIP	23592263
MIRT755019	hsa-miR-4655-5p	PAR-CLIP	23592263
MIRT754827	hsa-miR-4761-3p	PAR-CLIP	22100165
MIRT754828	hsa-miR-663b	PAR-CLIP	22100165
MIRT754829	hsa-miR-4435	PAR-CLIP	22100165
MIRT754830	hsa-miR-7108-5p	PAR-CLIP	22100165
MIRT754827	hsa-miR-4761-3p	PAR-CLIP	22100165
MIRT754828	hsa-miR-663b	PAR-CLIP	22100165
MIRT754829	hsa-miR-4435	PAR-CLIP	22100165
MIRT754830	hsa-miR-7108-5p	PAR-CLIP	22100165

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000123	Component	Histone acetyltransferase complex	IBA
GO:0000123	Component	Histone acetyltransferase complex	IDA	16387653
GO:0000123	Component	Histone acetyltransferase complex	IEA
GO:0001558	Process	Regulation of cell growth	ISS
GO:0005515	Function	Protein binding	IPI	20211142, 24981860, 25416956, 32814053, 33961781
GO:0005654	Component	Nucleoplasm	IDA	16387653
GO:0006275	Process	Regulation of DNA replication	IDA	16387653
GO:0006275	Process	Regulation of DNA replication	IEA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	ISS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0036408	Function	Histone H3K14 acetyltransferase activity	IDA	16387653
GO:0043995	Function	Histone H4K5 acetyltransferase activity	IDA	16387653
GO:0043996	Function	Histone H4K8 acetyltransferase activity	IDA	16387653
GO:0043997	Function	Histone H4K12 acetyltransferase activity	IDA	16387653
GO:0046872	Function	Metal ion binding	IEA
GO:0046972	Function	Histone H4K16 acetyltransferase activity	IDA	16387653
GO:0051726	Process	Regulation of cell cycle	IDA	16387653
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:2000278	Process	Regulation of DNA biosynthetic process	IDA	16387653
GO:2000278	Process	Regulation of DNA biosynthetic process	IEA

MIM	HGNC	e!Ensembl
610515	22984	ENSG00000043143

Q9NQC1

Protein name

E3 ubiquitin-protein ligase Jade-2 (EC 2.3.2.27) (Jade family PHD finger protein 2) (PHD finger protein 15)

Protein function

Scaffold subunit of some HBO1 complexes, which have a histone H4 acetyltransferase activity (PubMed:16387653). Acts as an E3 ubiquitin-protein ligase mediating the ubiquitination and subsequent proteasomal degradation of target protein histone d

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10513	EPL1	1 → 176	Enhancer of polycomb-like	Family
PF13831	PHD_2	213 → 247		Family
PF13832	zf-HC5HC2H_2	252 → 364		Domain

Sequence

MEEKRRKYSISSDNSDTTDSHATSTSASRCSKLPSSTKSGWPRQNEKKPSEVFRTDLITA
MKIPDSYQLSPDDYYILADPWRQEWEKGVQVPAGAEAIPEPVVRILPPLEGPPAQASPSS
TMLGEGSQPDWPGGSRYDLDEIDAYWLELINSELKEMERPELDELTLERVLEELETLCHQ
NMARAIETQEGLGIEYDEDVVCDVCRSPEGEDGNEMVFCDKCNVCVHQACYGILKVPTGS
WLCRTCALGVQPKCLLCPKRGGALKPTRSGTKWVHVSCALWIPEVSIGCPEKMEPITKIS
HIPASRWALSCSLCKECTGTCIQCSMPSCVTAFHVTCAFDHGLEMRTILADNDEVKFKSF
CQEHSDGGPRNEPTSEPTEPSQAGEDLEKVTLRKQRLQQLEEDFYELVEPAEVAERLDLA
EALVDFIYQYWKLKRKANANQPLLTPKTDEVDNLAQQEQDVLYRRLKLFTHLRQDLERVR
NLCYMVTRRERTKHAICKLQEQIFHLQMKLIEQDLCRGLSTSFPIDGTFFNSWLAQSVQI
TAENMAMSEWPLNNGHREDPAPGLLSEELLQDEETLLSFMRDPSLRPGDPARKARGRTRL
PAKKKPPPPPPQDGPGSRTTPDKAPKKTWGQDAGSGKGGQGPPTRKPPRRTSSHLPSSPA
AGDCPILATPESPPPLAPETPDEAASVAADSDVQVPGPAASPKPLGRLRPPRESKVTRRL
PGARPDAGMGPPSAVAERPKVSLHFDTETDGYFSDGEMSDSDVEAEDGGVQRGPREAGAE
EVVRMGVLAS

Sequence length

790

Interactions

View interactions

	Reactome
			HATs acetylate histones

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (18)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JADE2-associated Neurodevelopmental Disorder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (8)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Bipolar Disorder	Bipolar Disorder	GWASCAT_DG	31043756		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain neoplasms	Pubtator	34008756	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	28869590		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	28869590		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	34673934	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	34673934	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	29610475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	29610475		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

JADE2 (jade family PHD finger 2)