Gene Gene information from NCBI Gene database.
Entrez ID 23314
Gene name SATB homeobox 2
Gene symbol SATB2
Synonyms (NCBI Gene)
C2DELq32q33DEL2Q32Q33GLSS
Chromosome 2
Chromosome location 2q33.1
Summary This gene encodes a DNA binding protein that specifically binds nuclear matrix attachment regions. The encoded protein is involved in transcription regulation and chromatin remodeling. Defects in this gene are associated with isolated cleft palate and cog
SNPs SNP information provided by dbSNP.
71
SNP ID Visualize variation Clinical significance Consequence
rs137853127 G>A Pathogenic Stop gained, coding sequence variant, genic downstream transcript variant
rs797044874 G>A Pathogenic Coding sequence variant, stop gained, genic downstream transcript variant
rs863224917 G>A Likely-pathogenic Coding sequence variant, missense variant, genic downstream transcript variant
rs875989830 AC>- Pathogenic Frameshift variant, coding sequence variant, genic downstream transcript variant
rs878853163 T>A,C Pathogenic Coding sequence variant, stop gained, missense variant, genic downstream transcript variant
miRNA miRNA information provided by mirtarbase database.
371
miRTarBase ID miRNA Experiments Reference
MIRT006567 hsa-miR-31-5p Luciferase reporter assay 20980827
MIRT006567 hsa-miR-31-5p Luciferase reporter assay 20980827
MIRT025532 hsa-miR-34a-5p Sequencing 20371350
MIRT026761 hsa-miR-192-5p Microarray 19074876
MIRT045505 hsa-miR-149-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
38
GO ID Ontology Definition Evidence Reference
GO:0000118 Component Histone deacetylase complex IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 22825848
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
608148 21637 ENSG00000119042
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UPW6
Protein name DNA-binding protein SATB2 (Special AT-rich sequence-binding protein 2)
Protein function Binds to DNA, at nuclear matrix- or scaffold-associated regions. Thought to recognize the sugar-phosphate structure of double-stranded DNA. Transcription factor controlling nuclear gene expression, by binding to matrix attachment regions (MARs)
PDB 1WI3 , 1WIZ , 2CSF
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16534 ULD 58 156 Ubiquitin-like oligomerisation domain of SATB Domain
PF16557 CUTL 162 233 CUT1-like DNA-binding domain of SATB Domain
PF02376 CUT 355 434 CUT domain Domain
PF02376 CUT 478 557 CUT domain Domain
PF00046 Homeodomain 615 672 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: High expression in adult brain, moderate expression in fetal brain, and weak expression in adult liver, kidney, and spinal cord and in select brain regions, including amygdala, corpus callosum, caudate nucleus, and hippocampus. {ECO:00
Sequence
MERRSESPCLRDSPDRRSGSPDVKGPPPVKVARLEQNGSPMGARGRPNGAVAKAVGGLMI
PVFCVVEQLDGSLEYDNREEHAEFVLVRKDVLFSQLVETALLALGYSHSSAAQAQGIIKL
GRWNPLPLSYVTDAPDATVADMLQDVYHVVTLKIQL
QSCSKLEDLPAEQWNHATVRNALK
ELLKEMNQSTLAKECPLSQSMISSIVNSTYYANVSATKCQEFGRWYKKYKKIK
VERVERE
NLSDYCVLGQRPMHLPNMNQLASLGKTNEQSPHSQIHHSTPIRNQVPALQPIMSPGLLSP
QLSPQLVRQQIAMAHLINQQIAVSRLLAHQHPQAINQQFLNHPPIPRAVKPEPTNSSVEV
SPDIYQQVRDELKRASVSQAVFARVAFNRTQGLLSEILRKEEDPRTASQSLLVNLRAMQN
FLNLPEVERDRIYQ
DERERSMNPNVSMVSSASSSPSSSRTPQAKTSTPTTDLPIKVDGAN
INITAAIYDEIQQEMKRAKVSQALFAKVAANKSQGWLCELLRWKENPSPENRTLWENLCT
IRRFLNLPQHERDVIYE
EESRHHHSERMQHVVQLPPEPVQVLHRQQSQPAKESSPPREEA
PPPPPPTEDSCAKKPRSRTKISLEALGILQSFIHDVGLYPDQEAIHTLSAQLDLPKHTII
KFFQNQRYHVKH
HGKLKEHLGSAVDVAEYKDEELLTESEENDSEEGSEEMYKVEAEEENA
DKSKAAPAEIDQR
Sequence length 733
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    SUMOylation of chromatin organization proteins
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
47
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Autism spectrum disorder Likely pathogenic rs1692190479 RCV001291383
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cerebellar ataxia Pathogenic rs2105707111 RCV001526525
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Chromosome 2q32-q33 deletion syndrome Likely pathogenic; Pathogenic rs1688103803, rs1688726794, rs2105822776, rs2105795469, rs1223371144, rs2105822848, rs2105957137, rs2105768966, rs2105769270, rs1688108689, rs1559052017, rs2105928888, rs2105865785, rs2105865877, rs2105928782
View all (81 more)
RCV001334830
RCV001334829
RCV001375953
RCV001542466
RCV003120634
View all (93 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Cleft palate Pathogenic rs137853127 RCV001261363
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
AUTISM SPECTRUM DISORDERS Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CANCER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
2q32q33 microdeletion syndrome 2q32-q33 Deletion Syndrome Orphanet
★☆☆☆☆
Found in Text Mining only
2q32q33 microdeletion syndrome 2q32-q33 Deletion Syndrome BEFREE 19668335
★☆☆☆☆
Found in Text Mining only
2q33.1 microdeletion syndrome 2q33.1 microdeletion syndrome ORPHANET_DG 19668335, 21343628
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma BEFREE 28711650, 28914716, 28968158, 28969003, 29243296, 29396302, 29924451, 30001238, 30061246, 30710095, 31101576, 31318711
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of colon Adenocarcinoma Of Colon BEFREE 31101576
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of large intestine Colorectal Cancer BEFREE 28968158, 28969003, 29924451, 30710095, 31133441
★☆☆☆☆
Found in Text Mining only
Adenoma Adenoma BEFREE 31318711
★☆☆☆☆
Found in Text Mining only
Adrenomyeloneuropathy Adrenomyeloneuropathy BEFREE 28340228
★☆☆☆☆
Found in Text Mining only
Anaplasia Anaplasia BEFREE 27472393, 28167342
★☆☆☆☆
Found in Text Mining only
Anodontia Anodontia Pubtator 25118029 Associate
★☆☆☆☆
Found in Text Mining only