Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	23312
Gene name	Dmx like 2
Gene symbol	DMXL2
Synonyms (NCBI Gene)	DEE81DFNA71EIEE81PEPNSRC3
Chromosome	15
Chromosome location	15q21.2
Summary	This gene encodes a protein with 12 WD domains. Proteins with WD domains are involved in many functions including participation in signal transduction pathways. Participation of the encoded protein in regulation of the Notch signaling pathway has been dem

Show/Hide all (7)

SNP ID	Visualize variation	Clinical significance	Consequence
rs75378828	G>C,T	Conflicting-interpretations-of-pathogenicity	Non coding transcript variant, genic upstream transcript variant, missense variant, coding sequence variant
rs372749193	G>A,C	Pathogenic	Coding sequence variant, genic downstream transcript variant, non coding transcript variant, missense variant
rs606231461	TCCATTGCCATCACT>-	Pathogenic	Inframe deletion, non coding transcript variant, genic downstream transcript variant, coding sequence variant
rs754786373	C>T	Pathogenic	Non coding transcript variant, genic downstream transcript variant, coding sequence variant, missense variant
rs1595908479	C>T	Pathogenic	Splice acceptor variant, genic downstream transcript variant, intron variant
rs1595955503	->TAATCATG	Pathogenic	Non coding transcript variant, coding sequence variant, genic downstream transcript variant, frameshift variant
rs1596016716	G>C,T	Pathogenic	Non coding transcript variant, coding sequence variant, stop gained, intron variant

108

Show/Hide all (108)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028846	hsa-miR-26b-5p	Microarray	19088304
MIRT031117	hsa-miR-19b-3p	Sequencing	20371350
MIRT140253	hsa-miR-205-5p	HITS-CLIP	22473208
MIRT140246	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT031117	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT140253	hsa-miR-205-5p	HITS-CLIP	22473208
MIRT939461	hsa-miR-33a	CLIP-seq
MIRT939462	hsa-miR-33b	CLIP-seq
MIRT939463	hsa-miR-4325	CLIP-seq
MIRT939464	hsa-miR-507	CLIP-seq
MIRT939465	hsa-miR-513a-3p	CLIP-seq
MIRT939466	hsa-miR-557	CLIP-seq
MIRT939467	hsa-miR-105	CLIP-seq
MIRT939468	hsa-miR-1257	CLIP-seq
MIRT939469	hsa-miR-181a	CLIP-seq
MIRT939470	hsa-miR-181b	CLIP-seq
MIRT939471	hsa-miR-181c	CLIP-seq
MIRT939472	hsa-miR-181d	CLIP-seq
MIRT939473	hsa-miR-190	CLIP-seq
MIRT939474	hsa-miR-190b	CLIP-seq
MIRT939475	hsa-miR-19a	CLIP-seq
MIRT939476	hsa-miR-19b	CLIP-seq
MIRT939477	hsa-miR-216a	CLIP-seq
MIRT939478	hsa-miR-216b	CLIP-seq
MIRT939479	hsa-miR-23a	CLIP-seq
MIRT939480	hsa-miR-23b	CLIP-seq
MIRT939481	hsa-miR-23c	CLIP-seq
MIRT939482	hsa-miR-3121-3p	CLIP-seq
MIRT939483	hsa-miR-3143	CLIP-seq
MIRT939484	hsa-miR-3148	CLIP-seq
MIRT939485	hsa-miR-3613-3p	CLIP-seq
MIRT939486	hsa-miR-371-5p	CLIP-seq
MIRT939487	hsa-miR-371b-5p	CLIP-seq
MIRT939488	hsa-miR-4262	CLIP-seq
MIRT939489	hsa-miR-4274	CLIP-seq
MIRT939490	hsa-miR-4307	CLIP-seq
MIRT939491	hsa-miR-4427	CLIP-seq
MIRT939492	hsa-miR-4511	CLIP-seq
MIRT939493	hsa-miR-4519	CLIP-seq
MIRT939494	hsa-miR-455-3p	CLIP-seq
MIRT939495	hsa-miR-4639-5p	CLIP-seq
MIRT939496	hsa-miR-4680-3p	CLIP-seq
MIRT939497	hsa-miR-4762-3p	CLIP-seq
MIRT939498	hsa-miR-4773	CLIP-seq
MIRT939499	hsa-miR-4797-3p	CLIP-seq
MIRT939500	hsa-miR-543	CLIP-seq
MIRT939501	hsa-miR-548ac	CLIP-seq
MIRT939502	hsa-miR-548ae	CLIP-seq
MIRT939503	hsa-miR-548aj	CLIP-seq
MIRT939504	hsa-miR-548am	CLIP-seq
MIRT939505	hsa-miR-548b-3p	CLIP-seq
MIRT939506	hsa-miR-548d-3p	CLIP-seq
MIRT939507	hsa-miR-548x	CLIP-seq
MIRT939508	hsa-miR-548z	CLIP-seq
MIRT939509	hsa-miR-579	CLIP-seq
MIRT939510	hsa-miR-664	CLIP-seq
MIRT939511	hsa-miR-944	CLIP-seq
MIRT1977890	hsa-miR-1256	CLIP-seq
MIRT1977891	hsa-miR-140-3p	CLIP-seq
MIRT1977892	hsa-miR-186	CLIP-seq
MIRT1977893	hsa-miR-3919	CLIP-seq
MIRT1977894	hsa-miR-4528	CLIP-seq
MIRT1977895	hsa-miR-4659a-3p	CLIP-seq
MIRT1977896	hsa-miR-4659b-3p	CLIP-seq
MIRT1977897	hsa-miR-4699-3p	CLIP-seq
MIRT1977898	hsa-miR-4775	CLIP-seq
MIRT2213282	hsa-miR-1205	CLIP-seq
MIRT939468	hsa-miR-1257	CLIP-seq
MIRT939469	hsa-miR-181a	CLIP-seq
MIRT939470	hsa-miR-181b	CLIP-seq
MIRT939471	hsa-miR-181c	CLIP-seq
MIRT939472	hsa-miR-181d	CLIP-seq
MIRT2213283	hsa-miR-3977	CLIP-seq
MIRT2213284	hsa-miR-421	CLIP-seq
MIRT939488	hsa-miR-4262	CLIP-seq
MIRT2213285	hsa-miR-4272	CLIP-seq
MIRT2213286	hsa-miR-4418	CLIP-seq
MIRT2213287	hsa-miR-4493	CLIP-seq
MIRT2213288	hsa-miR-4709-5p	CLIP-seq
MIRT2213289	hsa-miR-509-3-5p	CLIP-seq
MIRT2213290	hsa-miR-509-5p	CLIP-seq
MIRT939500	hsa-miR-543	CLIP-seq
MIRT939509	hsa-miR-579	CLIP-seq
MIRT939469	hsa-miR-181a	CLIP-seq
MIRT939470	hsa-miR-181b	CLIP-seq
MIRT939471	hsa-miR-181c	CLIP-seq
MIRT939472	hsa-miR-181d	CLIP-seq
MIRT939473	hsa-miR-190	CLIP-seq
MIRT939474	hsa-miR-190b	CLIP-seq
MIRT2517041	hsa-miR-193a-3p	CLIP-seq
MIRT2517042	hsa-miR-193b	CLIP-seq
MIRT2517043	hsa-miR-203	CLIP-seq
MIRT939477	hsa-miR-216a	CLIP-seq
MIRT939483	hsa-miR-3143	CLIP-seq
MIRT939488	hsa-miR-4262	CLIP-seq
MIRT2517044	hsa-miR-4701-5p	CLIP-seq
MIRT939500	hsa-miR-543	CLIP-seq
MIRT939509	hsa-miR-579	CLIP-seq
MIRT2517045	hsa-miR-582-3p	CLIP-seq
MIRT2517046	hsa-miR-588	CLIP-seq
MIRT939510	hsa-miR-664	CLIP-seq
MIRT939511	hsa-miR-944	CLIP-seq
MIRT2517041	hsa-miR-193a-3p	CLIP-seq
MIRT2517042	hsa-miR-193b	CLIP-seq
MIRT939477	hsa-miR-216a	CLIP-seq
MIRT2517044	hsa-miR-4701-5p	CLIP-seq
MIRT2517045	hsa-miR-582-3p	CLIP-seq
MIRT2517046	hsa-miR-588	CLIP-seq

Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005615	Component	Extracellular space	HDA	22664934
GO:0007035	Process	Vacuolar acidification	IBA
GO:0008021	Component	Synaptic vesicle	IDA	11809763
GO:0016020	Component	Membrane	IEA
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0031267	Function	Small GTPase binding	IDA	11809763
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0043291	Component	RAVE complex	IBA
GO:0045202	Component	Synapse	IEA
GO:0098992	Component	Neuronal dense core vesicle	IEA

MIM	HGNC	e!Ensembl
612186	2938	ENSG00000104093

Q8TDJ6

Protein name

DmX-like protein 2 (Rabconnectin-3)

Protein function

May serve as a scaffold protein for MADD and RAB3GA on synaptic vesicles (PubMed:11809763). Plays a role in the brain as a key controller of neuronal and endocrine homeostatic processes (By similarity). {ECO:0000250|UniProtKB:Q8BPN8, ECO:0000269

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12234	Rav1p_C	1122 → 1425	RAVE protein 1 C terminal	Family
PF12234	Rav1p_C	1438 → 1904	RAVE protein 1 C terminal	Family
PF00400	WD40	2932 → 2970	WD domain, G-beta repeat	Repeat

Sequence

MHLHQVLTGAVNPGDNCYSVGSVGDVPFTAYGSGCDIVILANDFECVQIIPGAKHGNIQV
SCVECSNQQGRIAASYGNAVCIFEPLGINSHKRNCQLKCQWLKTGQFFLSSVTYNLAWDP
QDNRLLTATDSIQLWAPPGDDILEEEEEIDNTVPPVLNDWKCVWQCKTSVSVHLMEWSPD
GEYFATAGKDDCLLKVWYPMTGWKSSIIPQDHHEVKRRQSSTQFSFVYLAHPRAVTGFSW
RKTSKYMPRGSVCNVLLTSCHDGVCRLWAETLLPEDCLLGEQICETTTSSIASSLSHAGR
HKDRIQHALETIHHLKNLRKGQRRSSVLVTHAELMPDQTAMHEVQRHISHHANALCHFHI
AASINPATDIPNVLVGTAFNVDDGNGGFVVHWLNNKEFHFTSSTEVFMHQLRKLSDKQVD
HENDDADREDEEHSQEDRERGLHMKLDHDLSLDRESEAGTGSSEHEDGEREGSPRTYSRL
SVPMPLPTVLLDRKIETLLTEWNKNPDMLFTIHPVDGTFLVWHVKYLDEYNPGIFRQVQV
SFSSRIPVAFPSGDASSLSKNIMMYACINATKDSHHTLLHQEGMSVGSPHGSQPHSRSHS
THMNILAPTVMMISKHIDGSLNQWAVTFADKSAFTTVLTVSHKFRYCGHRFHLNDLACHS
VLPLLLTSSHHNALLTPELDCQWDSDNKLSRLMDPVKHIKGSSKQPLRNAATRTFHDPNA
IYSELILWRVDPIGPLSYTGGVSELARINSLHTSAFSNVAWLPTLIPSYCLGTYCNSASA
CFVASDGKNLRLYQAVVDARKLLDELSDPESSKLIGEVFNIVSQQSTARPGCIIELDAIT
NQCGSNTQLLHVFQEDFIIGYKPHKEDMEKKETEIFFQPSQGYRPPPFSEKFFLVVIEKD
SNNNSILHMWHLHLKSVQACLAKASEGASSESLLSVPGQKNVDSSPETSPSVSPMPHSSS
IANLQTASKLILSSRLVYSQPLDLPESVEVIRATPSAGHLSSSSIYPVCLAPYLVVTTCS
DNKVRFWKCCMEANPECNKSDEKEIYHWKRWPLMNDEGEDNSSTVSIVGRPVAVSCSYTG
RLAVAYKQPIHHNGFVSKEFSMHVCIFECESTGGSEWVLEQTIHLDDLVKVGSVLDSRVS
VDSNLFVYSKSDALLSKDRYLIPNIKHLVHLDWVSKEDGSHILTVGVGANIFMYGRLSGI
VTEQTNSKDGVAVITLPLGGSIKQGVKSRWVLLRSIDLVSSVDGTPSLPVSLSWVRDGIL
VVGMDCEMHVYAQWKHAVKFGDTEADSSNAEEAAMQDHSTFKSNMLARKSVVEGTAISDD
VFCSPTVIQDGGLFEAAHVLSPTLPQYHPTQLLELMDLGKVRRAKAILSHLVKCIAGEVA
IVRDPDAGEGTKRHLSRTISVSGSTAKETVTVGKDGTRDYTEIDSIPPLPLYALLAADQD
TSYRISEESTKIPQSYEDQTVSQPEDQYSELFQIQDIPTDDIDLEPEKRENKSKVINLSQ
YGPAYFGQEHARVLSSHLMHSSLPGLTRLEQMFLVALADTVATTSTELDESRDKSCSGRD
TLDECGLRYLLAMRLHTCLLTSLPPLYRVQLLHQGVSTCHFAWAFHSEAEEELINMIPAI
QRGDPQWSELRAMGIGWWVRNINTLRRCIEKVAKASFQRNNDALDAALFYLSMKKKAVVW
GLFRSQHDEKMTTFFSHNFNEDRWRKAALKNAFSLLGKQRFEQSAAFFLLAGSLKDAIEV
CLEKMEDIQLAMVIARLYESEFETSSTYISILNQKILGCQKDGSGFSCKRLHPDPFLRSL
AYWVMKDYTRALDTLLEQTPKEDDEHQVIIKSCNPVAFSFYNYLRTHPLLIRRNLASPEG
TLATLGLKTEKNFVDKINLIERKLFFTTANAHFKVGCPVLALEVLSKIPKVTKTSALSAK
KDQPDFISHRMDDVPSHSKALSDGNGSSGIEWSNVTSSQYDWSQPIVKVDEEPLNLDWGE
DHDSALDEEEDDAVGLVMKSTDAREKDKQSDQKASDPNMLLTPQEEDDPEGDTEVDVIAE
QLKFRACLKILMTELRTLATGYEVDGGKLRFQLYNWLEKEIAALHEICNHESVIKEYSSK
TYSKVESDLLDQEEMVDKPDIGSYERHQIERRRLQAKREHAERRKSWLQKNQDLLRVFLS
YCSLHGAQGGGLASVRMELKFLLQESQQETTVKQLQSPLPLPTTLPLLSASIASTKTVIA
NPVLYLNNHIHDILYTIVQMKTPPHPSIEDVKVHTLHSLAASLSASIYQALCDSHSYSQT
EGNQFTGMAYQGLLLSDRRRLRTESIEEHATPNSSPAQWPGVSSLINLLSSAQDEDQPKL
NILLCEAVVAVYLSLLIHALATNSSSELFRLAAHPLNNRMWAAVFGGGVKLVVKPRRQSE
NISAPPVLSEDIDKHRRRFNMRMLVPGRPVKDATPPPVPAERPSYKEKFIPPELSMWDYF
VAKPFLPLSDSGVIYDSDESIHSDEEDDAFFSDTQIQEHQDPNSYSWALLHLTMVKLALH
NVKNFFPIAGLEFSELPVTSPLGIAVIKNLENWEQILQEKMDQFEGPPPNYINTYPTDLS
VGAGPAILRNKAMLEPENTPFKSRDSSAFPVKRLWHFLVKQEVLQETFIRYIFTKKRKQS
EVEADLGYPGGKAKVIHKESDMIMAFSVNKANCNEIVLASTHDVQELDVTSLLACQSYIW
IGEEYDRESKSSDDVDYRGSTTTLYQPSATSYSASQVHPPSSLPWLGTGQTSTGASVLMK
RNLHNVKRMTSHPVHQYYLTGAQDGSVRMFEWTRPQQLVCFRQAGNARVTRLYFNSQGNK
CGVADGEGFLSIWQVNQTASNPKPYMSWQCHSKATSDFAFITSSSLVATSGHSNDNRNVC
LWDTLISPGNSLIHGFTCHDHGATVLQYAPKQQLLISGGRKGHVCIFDIRQRQLIHTFQA
HDSAIKALALDPYEEYFTTGSAEGNIKVWRLTGHGLIHSFKSEHAKQSIFRNIGAGVMQI
DIIQGNRLFSCGADGTLKTRVLPNAFNIPNRILDIL

Sequence length

3036

Interactions

View interactions

	KEGG
	Lysosome

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Developmental and epileptic encephalopathy, 81	Pathogenic; Likely pathogenic	rs1596016716, rs2548486231, rs1595955503, rs372749193, rs1595908479	RCV000856588 RCV004556965 RCV000856587 RCV000856589 RCV000856590 RCV000856591 View all (1 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
DMXL2-related disorder	Likely pathogenic; Pathogenic	rs1325372369	RCV005230533	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hearing loss, autosomal dominant 71	Pathogenic	rs2140933776	RCV001376159	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (38)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amenorrhea	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA NERVOSA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism spectrum disorder	association	ClinVar GWAS catalog	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL DOMINANT ISOLATED SENSORINEURAL DEAFNESS TYPE DFNA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEAFNESS, AUTOSOMAL DOMINANT 71	—	Disgenet, HPO Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEVELOPMENTAL AND EPILEPTIC ENCEPHALOPATHY 81	—	Disgenet, HPO Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EARLY INFANTILE DEVELOPMENTAL AND EPILEPTIC ENCEPHALOPATHY	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EARLY INFANTILE EPILEPTIC ENCEPHALOPATHY WITH SUPPRESSION BURSTS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENETIC DEVELOPMENTAL AND EPILEPTIC ENCEPHALOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hearing impairment	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Uncertain significance; Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonsyndromic genetic hearing loss	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pituitary stalk interruption syndrome	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Polyendocrine-polyneuropathy syndrome	Uncertain significance; Benign; Conflicting classifications of pathogenicity; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY ALDOSTERONISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Spasticity	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (38)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Autism Spectrum Disorder	Autism	Pubtator	30732576	Associate	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	30732576		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autosomal dominant non-syndromic sensorineural deafness type DFNA	Non-Syndromic Sensorineural Deafness	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	36226612	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26093085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26093085	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Central hypothyroidism	Central hypothyroidism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	19023099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clumsiness - motor delay	Motor delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
DEAFNESS, AUTOSOMAL DOMINANT 71	Deafness	UNIPROT_DG	27657680		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEAFNESS, AUTOSOMAL RECESSIVE (disorder)	Deafness	CLINGEN_DG	22875945, 27657680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	30732576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysarthria	Dysarthria	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Early infantile epileptic encephalopathy	Epileptic encephalopathy	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Early infantile epileptic encephalopathy with suppression bursts	Epileptic Encephalopathy	BEFREE	31688942		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial aplasia of the vermis	Cerebellar vermis agenesis	BEFREE	30924151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	33715530	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Hypogonadotropic Hypogonadism	Hypogonadotropic hypogonadism	Pubtator	33208564, 36700485	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	27957681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37544338	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26093085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	27957681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Moderate intellectual disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	30732576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonsyndromic Deafness	Nonsyndromic Deafness	BEFREE	27657680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	30732576		★★★★★ ★☆☆☆☆ Found in Text Mining only
POLYENDOCRINE-POLYNEUROPATHY SYNDROME	Polyendocrine-Polyneuropathy Syndrome	GENOMICS_ENGLAND_DG	25248098, 30732576, 31688942		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYENDOCRINE-POLYNEUROPATHY SYNDROME	Polyendocrine-Polyneuropathy Syndrome	ORPHANET_DG	25248098		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polyendocrine-polyneuropathy syndrome	Polyendocrine-Polyneuropathy Syndrome	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYENDOCRINE-POLYNEUROPATHY SYNDROME	Polyendocrine-Polyneuropathy Syndrome	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polyneuropathy	Polyneuropathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	28168735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	GENOMICS_ENGLAND_DG	22875945, 25248098, 27657680, 31688942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
X-linked infantile spasms	Spasms X-Linked	BEFREE	31688942		★★★★★ ★☆☆☆☆ Found in Text Mining only

DMXL2 (Dmx like 2)