Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2331
Gene name	Fibromodulin
Gene symbol	FMOD
Synonyms (NCBI Gene)	FMSLRR2E
Chromosome	1
Chromosome location	1q32.1
Summary	Fibromodulin belongs to the family of small interstitial proteoglycans. The encoded protein possesses a central region containing leucine-rich repeats with 4 keratan sulfate chains, flanked by terminal domains containing disulphide bonds. Owing to the int

156

Show/Hide all (156)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001188	hsa-miR-21-5p	Western blot	19906824
MIRT022505	hsa-miR-124-3p	Microarray	18668037
MIRT999757	hsa-miR-1294	CLIP-seq
MIRT999758	hsa-miR-3119	CLIP-seq
MIRT999759	hsa-miR-3162-5p	CLIP-seq
MIRT999760	hsa-miR-3180-5p	CLIP-seq
MIRT999761	hsa-miR-4685-5p	CLIP-seq
MIRT999762	hsa-miR-4710	CLIP-seq
MIRT999763	hsa-miR-656	CLIP-seq
MIRT1996329	hsa-miR-18a	CLIP-seq
MIRT1996330	hsa-miR-18b	CLIP-seq
MIRT1996331	hsa-miR-330-3p	CLIP-seq
MIRT1996332	hsa-miR-3977	CLIP-seq
MIRT1996333	hsa-miR-4422	CLIP-seq
MIRT1996334	hsa-miR-4672	CLIP-seq
MIRT1996335	hsa-miR-4717-3p	CLIP-seq
MIRT1996336	hsa-miR-4735-3p	CLIP-seq
MIRT2230274	hsa-miR-125a-5p	CLIP-seq
MIRT2230275	hsa-miR-125b	CLIP-seq
MIRT999757	hsa-miR-1294	CLIP-seq
MIRT2230276	hsa-miR-214	CLIP-seq
MIRT2230277	hsa-miR-298	CLIP-seq
MIRT999758	hsa-miR-3119	CLIP-seq
MIRT999759	hsa-miR-3162-5p	CLIP-seq
MIRT999760	hsa-miR-3180-5p	CLIP-seq
MIRT2230278	hsa-miR-3619-5p	CLIP-seq
MIRT2230279	hsa-miR-3909	CLIP-seq
MIRT2230280	hsa-miR-4291	CLIP-seq
MIRT2230281	hsa-miR-4319	CLIP-seq
MIRT999761	hsa-miR-4685-5p	CLIP-seq
MIRT999762	hsa-miR-4710	CLIP-seq
MIRT2230282	hsa-miR-4732-3p	CLIP-seq
MIRT2230283	hsa-miR-670	CLIP-seq
MIRT2230284	hsa-miR-761	CLIP-seq
MIRT2230285	hsa-miR-922	CLIP-seq
MIRT2388042	hsa-miR-1261	CLIP-seq
MIRT999757	hsa-miR-1294	CLIP-seq
MIRT2388043	hsa-miR-3074-5p	CLIP-seq
MIRT999758	hsa-miR-3119	CLIP-seq
MIRT999759	hsa-miR-3162-5p	CLIP-seq
MIRT999760	hsa-miR-3180-5p	CLIP-seq
MIRT2388044	hsa-miR-3667-3p	CLIP-seq
MIRT2388045	hsa-miR-370	CLIP-seq
MIRT999761	hsa-miR-4685-5p	CLIP-seq
MIRT999762	hsa-miR-4710	CLIP-seq
MIRT2534086	hsa-miR-105	CLIP-seq
MIRT2534087	hsa-miR-1207-3p	CLIP-seq
MIRT2534088	hsa-miR-122	CLIP-seq
MIRT2534089	hsa-miR-124	CLIP-seq
MIRT2534090	hsa-miR-1253	CLIP-seq
MIRT2534091	hsa-miR-1262	CLIP-seq
MIRT2534092	hsa-miR-1285	CLIP-seq
MIRT2534093	hsa-miR-1290	CLIP-seq
MIRT2534094	hsa-miR-1827	CLIP-seq
MIRT2534095	hsa-miR-202	CLIP-seq
MIRT2534096	hsa-miR-31	CLIP-seq
MIRT2534097	hsa-miR-3167	CLIP-seq
MIRT2534098	hsa-miR-3187-5p	CLIP-seq
MIRT2534099	hsa-miR-338-3p	CLIP-seq
MIRT2534100	hsa-miR-3616-5p	CLIP-seq
MIRT2534101	hsa-miR-3647-5p	CLIP-seq
MIRT2534102	hsa-miR-3681	CLIP-seq
MIRT2534103	hsa-miR-3690	CLIP-seq
MIRT2534104	hsa-miR-3714	CLIP-seq
MIRT2534105	hsa-miR-3910	CLIP-seq
MIRT2534106	hsa-miR-3942-3p	CLIP-seq
MIRT2534107	hsa-miR-4252	CLIP-seq
MIRT2534108	hsa-miR-4254	CLIP-seq
MIRT2534109	hsa-miR-4283	CLIP-seq
MIRT2534110	hsa-miR-4330	CLIP-seq
MIRT2534111	hsa-miR-4481	CLIP-seq
MIRT2534112	hsa-miR-4511	CLIP-seq
MIRT2534113	hsa-miR-4522	CLIP-seq
MIRT2534114	hsa-miR-4530	CLIP-seq
MIRT2534115	hsa-miR-4535	CLIP-seq
MIRT2534116	hsa-miR-4670-3p	CLIP-seq
MIRT2534117	hsa-miR-4701-3p	CLIP-seq
MIRT1996335	hsa-miR-4717-3p	CLIP-seq
MIRT2534118	hsa-miR-4720-3p	CLIP-seq
MIRT2534119	hsa-miR-4745-5p	CLIP-seq
MIRT2534120	hsa-miR-4747-5p	CLIP-seq
MIRT2534121	hsa-miR-4793-5p	CLIP-seq
MIRT2534122	hsa-miR-4795-5p	CLIP-seq
MIRT2534123	hsa-miR-4796-3p	CLIP-seq
MIRT2534124	hsa-miR-4804-3p	CLIP-seq
MIRT2534125	hsa-miR-492	CLIP-seq
MIRT2534126	hsa-miR-506	CLIP-seq
MIRT2534127	hsa-miR-545	CLIP-seq
MIRT2534128	hsa-miR-548p	CLIP-seq
MIRT2534129	hsa-miR-573	CLIP-seq
MIRT2534130	hsa-miR-580	CLIP-seq
MIRT2534131	hsa-miR-612	CLIP-seq
MIRT2534132	hsa-miR-765	CLIP-seq
MIRT2534133	hsa-miR-876-5p	CLIP-seq
MIRT2534086	hsa-miR-105	CLIP-seq
MIRT2534087	hsa-miR-1207-3p	CLIP-seq
MIRT2534088	hsa-miR-122	CLIP-seq
MIRT2681056	hsa-miR-1237	CLIP-seq
MIRT2534089	hsa-miR-124	CLIP-seq
MIRT2681057	hsa-miR-1248	CLIP-seq
MIRT2534090	hsa-miR-1253	CLIP-seq
MIRT2534091	hsa-miR-1262	CLIP-seq
MIRT2534092	hsa-miR-1285	CLIP-seq
MIRT2534093	hsa-miR-1290	CLIP-seq
MIRT2681058	hsa-miR-1587	CLIP-seq
MIRT2534094	hsa-miR-1827	CLIP-seq
MIRT2534095	hsa-miR-202	CLIP-seq
MIRT2681059	hsa-miR-3065-5p	CLIP-seq
MIRT2534096	hsa-miR-31	CLIP-seq
MIRT2681060	hsa-miR-3115	CLIP-seq
MIRT2534097	hsa-miR-3167	CLIP-seq
MIRT2681061	hsa-miR-3170	CLIP-seq
MIRT2534098	hsa-miR-3187-5p	CLIP-seq
MIRT2534099	hsa-miR-338-3p	CLIP-seq
MIRT2534100	hsa-miR-3616-5p	CLIP-seq
MIRT2534101	hsa-miR-3647-5p	CLIP-seq
MIRT2681062	hsa-miR-3675-5p	CLIP-seq
MIRT2534102	hsa-miR-3681	CLIP-seq
MIRT2534103	hsa-miR-3690	CLIP-seq
MIRT2534104	hsa-miR-3714	CLIP-seq
MIRT2534105	hsa-miR-3910	CLIP-seq
MIRT2534106	hsa-miR-3942-3p	CLIP-seq
MIRT2534107	hsa-miR-4252	CLIP-seq
MIRT2534108	hsa-miR-4254	CLIP-seq
MIRT2534109	hsa-miR-4283	CLIP-seq
MIRT2534110	hsa-miR-4330	CLIP-seq
MIRT2681063	hsa-miR-4419a	CLIP-seq
MIRT2534111	hsa-miR-4481	CLIP-seq
MIRT2681064	hsa-miR-4510	CLIP-seq
MIRT2534112	hsa-miR-4511	CLIP-seq
MIRT2534113	hsa-miR-4522	CLIP-seq
MIRT2534114	hsa-miR-4530	CLIP-seq
MIRT2534115	hsa-miR-4535	CLIP-seq
MIRT2534116	hsa-miR-4670-3p	CLIP-seq
MIRT2681065	hsa-miR-4674	CLIP-seq
MIRT2681066	hsa-miR-4690-3p	CLIP-seq
MIRT2534117	hsa-miR-4701-3p	CLIP-seq
MIRT1996335	hsa-miR-4717-3p	CLIP-seq
MIRT2534118	hsa-miR-4720-3p	CLIP-seq
MIRT2534119	hsa-miR-4745-5p	CLIP-seq
MIRT2534120	hsa-miR-4747-5p	CLIP-seq
MIRT2534121	hsa-miR-4793-5p	CLIP-seq
MIRT2534122	hsa-miR-4795-5p	CLIP-seq
MIRT2534123	hsa-miR-4796-3p	CLIP-seq
MIRT2534124	hsa-miR-4804-3p	CLIP-seq
MIRT2534125	hsa-miR-492	CLIP-seq
MIRT2681067	hsa-miR-494	CLIP-seq
MIRT2534126	hsa-miR-506	CLIP-seq
MIRT2534127	hsa-miR-545	CLIP-seq
MIRT2534128	hsa-miR-548p	CLIP-seq
MIRT2534129	hsa-miR-573	CLIP-seq
MIRT2534130	hsa-miR-580	CLIP-seq
MIRT2534131	hsa-miR-612	CLIP-seq
MIRT2534132	hsa-miR-765	CLIP-seq
MIRT2534133	hsa-miR-876-5p	CLIP-seq
MIRT2681068	hsa-miR-9	CLIP-seq

Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	20551380
GO:0005615	Component	Extracellular space	IBA
GO:0005796	Component	Golgi lumen	TAS
GO:0007181	Process	Transforming growth factor beta receptor complex assembly	TAS	8093006
GO:0030021	Function	Extracellular matrix structural constituent conferring compression resistance	RCA	20551380, 27559042
GO:0030199	Process	Collagen fibril organization	IEA
GO:0031012	Component	Extracellular matrix	HDA	20551380
GO:0031012	Component	Extracellular matrix	HDA	27559042
GO:0031012	Component	Extracellular matrix	IEA
GO:0031012	Component	Extracellular matrix	TAS	8093006
GO:0043202	Component	Lysosomal lumen	TAS

MIM	HGNC	e!Ensembl
600245	3774	ENSG00000122176

Q06828

Protein name

Fibromodulin (FM) (Collagen-binding 59 kDa protein) (Keratan sulfate proteoglycan fibromodulin) (KSPG fibromodulin)

Protein function

Affects the rate of fibrils formation. May have a primary role in collagen fibrillogenesis (By similarity).

PDB

5MX0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01462	LRRNT	75 → 104	Leucine rich repeat N-terminal domain	Family
PF13855	LRR_8	105 → 167	Leucine rich repeat	Repeat
PF13855	LRR_8	176 → 235	Leucine rich repeat	Repeat
PF13855	LRR_8	244 → 305	Leucine rich repeat	Repeat

Sequence

MQWTSLLLLAGLFSLSQAQYEDDPHWWFHYLRSQQSTYYDPYDPYPYETYEPYPYGVDEG
PAYTYGSPSPPDPRDCPQECDCPPNFPTAMYCDNRNLKYLPFVPSRMKYVYFQNNQITSI
QEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRE
LHLDHNQISRVPNNALEGLENLTALYLQHNEIQEVGSSMRGLRSLILLDLSYNHLRKVPD
GLPSALEQLYMEHNNVYTVPDSYFRGAPKLLYVRLSHNSLTNNGLASNTFNSSSLLELDL
SYNQLQKIPPVNTNLENLYLQGNRINEFSISSFCTVVDVVNFSKLQVLRLDGNEIKRSAM
PADAPLCLRLASLIEI

Sequence length

376

Interactions

View interactions

	KEGG		Reactome
	TGF-beta signaling pathway		Keratan sulfate biosynthesis Keratan sulfate degradation Defective CHST6 causes MCDC1 Defective ST3GAL3 causes MCT12 and EIEE15 Defective B4GALT1 causes B4GALT1-CDG (CDG-2d)

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (59)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Age related macular degeneration	Age-related macular degeneration	BEFREE	17293598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	19474808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	19474808		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30144066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28599447, 31824307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	34362365	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	15471955, 20813009, 23826326, 26318878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	15471955, 15741214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	22138190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28827814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30052659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28419987, 30144066, 30700002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	33887734	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Distal Myopathies	Distal myopathy	Pubtator	38015635	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	26600400, 31198406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	22138190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	27212030, 30176167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30176167	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	27212030, 30176167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	27212030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30052659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	39563337	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	11012890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	11012890	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	36033826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	22925684, 26600400	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	26600400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	26600400, 31182687	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	22138190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	26600400	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	31198406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	32530577	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	17293598	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	LHGDN	15741214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28599447, 31824307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26600400, 26689247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26600400, 31198406, 31824307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35737114	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation Autosomal Recessive 1	Intellectual developmental disorder	Pubtator	30959842	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	20727350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitral Valve Prolapse	Mitral valve prolapse	Pubtator	27213335	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	15592176, 19710942	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15471955, 16773189, 26600400, 28827814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	19543202	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	31831391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	29630675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	29630675	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	30298106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26600400, 26689247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Diseases	Prostatic Diseases	BEFREE	26689247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Diseases	Prostatic disease	Pubtator	26689247	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	35686032	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26600400, 26689247, 35686032, 39174928	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe myopia	Myopia	BEFREE	15592176, 17117407, 19710942, 21743019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	28081464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36966276	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	31305260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34247360	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	26600400, 31198406		★★★★★ ★☆☆☆☆ Found in Text Mining only

FMOD (fibromodulin)