ICOSLG (inducible T cell costimulator ligand)

Gene

• Entrez ID: 23308
• Gene name: Inducible T cell costimulator ligand
• Gene symbol: ICOSLG
• Synonyms (NCBI Gene): B7-H2, B7H2, B7RP-1, B7RP1, B7h, CD275, GL50, ICOS-L, ICOSL, IMD119, LICOS
• Chromosome: 21
• Chromosome location: 21q22.3

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1165558487	C>A,T	Likely-pathogenic	Intron variant, splice donor variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT039046	hsa-miR-766-3p	CLASH	23622248
MIRT716789	hsa-miR-6769a-3p	HITS-CLIP	19536157
MIRT716790	hsa-miR-4733-3p	HITS-CLIP	19536157
MIRT716788	hsa-miR-4459	HITS-CLIP	19536157
MIRT716787	hsa-miR-665	HITS-CLIP	19536157
MIRT716786	hsa-miR-6841-3p	HITS-CLIP	19536157
MIRT716785	hsa-miR-671-5p	HITS-CLIP	19536157
MIRT716784	hsa-miR-766-5p	HITS-CLIP	19536157
MIRT716783	hsa-miR-6511b-5p	HITS-CLIP	19536157
MIRT716782	hsa-miR-6811-5p	HITS-CLIP	19536157
MIRT691265	hsa-miR-548c-3p	HITS-CLIP	23313552
MIRT691264	hsa-miR-7849-3p	HITS-CLIP	23313552
MIRT691263	hsa-miR-619-3p	HITS-CLIP	23313552
MIRT691262	hsa-miR-7851-3p	HITS-CLIP	23313552
MIRT691261	hsa-miR-4666a-3p	HITS-CLIP	23313552
MIRT691260	hsa-miR-4275	HITS-CLIP	23313552
MIRT691259	hsa-miR-339-5p	HITS-CLIP	23313552
MIRT691258	hsa-miR-4421	HITS-CLIP	23313552
MIRT691257	hsa-miR-5699-3p	HITS-CLIP	23313552
MIRT691256	hsa-miR-6895-3p	HITS-CLIP	23313552
MIRT691255	hsa-miR-593-3p	HITS-CLIP	23313552
MIRT691254	hsa-miR-4684-5p	HITS-CLIP	23313552
MIRT691253	hsa-miR-6818-3p	HITS-CLIP	23313552
MIRT672851	hsa-miR-500b-3p	HITS-CLIP	23824327
MIRT672850	hsa-miR-6773-3p	HITS-CLIP	23824327
MIRT672849	hsa-miR-215-3p	HITS-CLIP	23824327
MIRT672848	hsa-miR-924	HITS-CLIP	23824327
MIRT672847	hsa-miR-3194-3p	HITS-CLIP	23824327
MIRT672846	hsa-miR-4294	HITS-CLIP	23824327
MIRT672845	hsa-miR-6879-3p	HITS-CLIP	23824327
MIRT672844	hsa-miR-431-5p	HITS-CLIP	23824327
MIRT672843	hsa-miR-3672	HITS-CLIP	23824327
MIRT672842	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT672841	hsa-miR-5691	HITS-CLIP	23824327
MIRT672840	hsa-miR-6805-3p	HITS-CLIP	23824327
MIRT672839	hsa-miR-8055	HITS-CLIP	23824327
MIRT672838	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT657255	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT657255	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT657254	hsa-miR-5193	HITS-CLIP	23824327
MIRT657253	hsa-miR-937-5p	HITS-CLIP	23824327
MIRT657252	hsa-miR-627-5p	HITS-CLIP	23824327
MIRT657251	hsa-miR-4273	HITS-CLIP	23824327
MIRT657250	hsa-miR-7156-5p	HITS-CLIP	23824327
MIRT657249	hsa-miR-4677-5p	HITS-CLIP	23824327
MIRT657247	hsa-miR-8081	HITS-CLIP	23824327
MIRT657248	hsa-miR-375	HITS-CLIP	23824327
MIRT657246	hsa-miR-6739-3p	HITS-CLIP	23824327
MIRT475367	hsa-miR-4781-5p	PAR-CLIP	20371350
MIRT475365	hsa-miR-1296-3p	PAR-CLIP	20371350
MIRT475364	hsa-miR-194-3p	PAR-CLIP	20371350
MIRT475363	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT475362	hsa-miR-8085	PAR-CLIP	20371350
MIRT475361	hsa-miR-3175	PAR-CLIP	20371350
MIRT493542	hsa-miR-1343-5p	PAR-CLIP	20371350
MIRT493541	hsa-miR-939-5p	PAR-CLIP	20371350
MIRT475360	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT475359	hsa-miR-4792	PAR-CLIP	20371350
MIRT475358	hsa-miR-491-5p	PAR-CLIP	20371350
MIRT475357	hsa-miR-3150a-3p	PAR-CLIP	20371350
MIRT475356	hsa-miR-6763-5p	PAR-CLIP	20371350
MIRT475367	hsa-miR-4781-5p	PAR-CLIP	20371350
MIRT475365	hsa-miR-1296-3p	PAR-CLIP	20371350
MIRT475364	hsa-miR-194-3p	PAR-CLIP	20371350
MIRT475363	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT475362	hsa-miR-8085	PAR-CLIP	20371350
MIRT475361	hsa-miR-3175	PAR-CLIP	20371350
MIRT493542	hsa-miR-1343-5p	PAR-CLIP	20371350
MIRT493541	hsa-miR-939-5p	PAR-CLIP	20371350
MIRT475360	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT475359	hsa-miR-4792	PAR-CLIP	20371350
MIRT475358	hsa-miR-491-5p	PAR-CLIP	20371350
MIRT475357	hsa-miR-3150a-3p	PAR-CLIP	20371350
MIRT475356	hsa-miR-6763-5p	PAR-CLIP	20371350
MIRT475367	hsa-miR-4781-5p	PAR-CLIP	20371350
MIRT475365	hsa-miR-1296-3p	PAR-CLIP	20371350
MIRT475364	hsa-miR-194-3p	PAR-CLIP	20371350
MIRT475363	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT475362	hsa-miR-8085	PAR-CLIP	20371350
MIRT475361	hsa-miR-3175	PAR-CLIP	20371350
MIRT493542	hsa-miR-1343-5p	PAR-CLIP	20371350
MIRT493541	hsa-miR-939-5p	PAR-CLIP	20371350
MIRT475360	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT475359	hsa-miR-4792	PAR-CLIP	20371350
MIRT475358	hsa-miR-491-5p	PAR-CLIP	20371350
MIRT475357	hsa-miR-3150a-3p	PAR-CLIP	20371350
MIRT475356	hsa-miR-6763-5p	PAR-CLIP	20371350
MIRT475367	hsa-miR-4781-5p	PAR-CLIP	20371350
MIRT475365	hsa-miR-1296-3p	PAR-CLIP	20371350
MIRT475364	hsa-miR-194-3p	PAR-CLIP	20371350
MIRT475363	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT475362	hsa-miR-8085	PAR-CLIP	20371350
MIRT475361	hsa-miR-3175	PAR-CLIP	20371350
MIRT493542	hsa-miR-1343-5p	PAR-CLIP	20371350
MIRT493541	hsa-miR-939-5p	PAR-CLIP	20371350
MIRT475360	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT475359	hsa-miR-4792	PAR-CLIP	20371350
MIRT475358	hsa-miR-491-5p	PAR-CLIP	20371350
MIRT475357	hsa-miR-3150a-3p	PAR-CLIP	20371350
MIRT475356	hsa-miR-6763-5p	PAR-CLIP	20371350
MIRT527242	hsa-miR-548ae-3p	PAR-CLIP	22012620
MIRT527241	hsa-miR-548ah-3p	PAR-CLIP	22012620
MIRT527240	hsa-miR-548aj-3p	PAR-CLIP	22012620
MIRT527239	hsa-miR-548am-3p	PAR-CLIP	22012620
MIRT527238	hsa-miR-548aq-3p	PAR-CLIP	22012620
MIRT527237	hsa-miR-548j-3p	PAR-CLIP	22012620
MIRT527236	hsa-miR-548x-3p	PAR-CLIP	22012620
MIRT527235	hsa-miR-490-3p	PAR-CLIP	22012620
MIRT527234	hsa-miR-649	PAR-CLIP	22012620
MIRT527233	hsa-miR-618	PAR-CLIP	22012620
MIRT527231	hsa-miR-4714-5p	PAR-CLIP	22012620
MIRT527232	hsa-miR-146a-3p	PAR-CLIP	22012620
MIRT475367	hsa-miR-4781-5p	PAR-CLIP	23592263
MIRT475365	hsa-miR-1296-3p	PAR-CLIP	23592263
MIRT475364	hsa-miR-194-3p	PAR-CLIP	23592263
MIRT493545	hsa-miR-3160-3p	PAR-CLIP	23592263
MIRT493544	hsa-miR-558	PAR-CLIP	23592263
MIRT493543	hsa-miR-4487	PAR-CLIP	23592263
MIRT475363	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT475362	hsa-miR-8085	PAR-CLIP	23592263
MIRT475361	hsa-miR-3175	PAR-CLIP	23592263
MIRT493542	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT493541	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT475360	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT475359	hsa-miR-4792	PAR-CLIP	23592263
MIRT475358	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT475357	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT475356	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT475367	hsa-miR-4781-5p	PAR-CLIP	23592263
MIRT475365	hsa-miR-1296-3p	PAR-CLIP	23592263
MIRT475364	hsa-miR-194-3p	PAR-CLIP	23592263
MIRT475363	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT475362	hsa-miR-8085	PAR-CLIP	23592263
MIRT475361	hsa-miR-3175	PAR-CLIP	23592263
MIRT475360	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT475359	hsa-miR-4792	PAR-CLIP	23592263
MIRT475358	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT475357	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT475356	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT475393	hsa-miR-3154	PAR-CLIP	23592263
MIRT475392	hsa-miR-1197	PAR-CLIP	23592263
MIRT475391	hsa-miR-4779	PAR-CLIP	23592263
MIRT475389	hsa-miR-1321	PAR-CLIP	23592263
MIRT475390	hsa-miR-4739	PAR-CLIP	23592263
MIRT475388	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT475387	hsa-miR-6755-5p	PAR-CLIP	23592263
MIRT475386	hsa-miR-3927-3p	PAR-CLIP	23592263
MIRT475385	hsa-miR-6831-5p	PAR-CLIP	23592263
MIRT475384	hsa-miR-7515	PAR-CLIP	23592263
MIRT475383	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT475382	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT475381	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT475380	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT475379	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT475378	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT475377	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT475376	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT475375	hsa-miR-4458	PAR-CLIP	23592263
MIRT475374	hsa-miR-4500	PAR-CLIP	23592263
MIRT475373	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT475372	hsa-miR-7-5p	PAR-CLIP	23592263
MIRT475371	hsa-miR-765	PAR-CLIP	23592263
MIRT475370	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT475368	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT475369	hsa-miR-4650-3p	PAR-CLIP	23592263
MIRT475366	hsa-miR-6780a-5p	PAR-CLIP	23592263
MIRT475367	hsa-miR-4781-5p	PAR-CLIP	23592263
MIRT475365	hsa-miR-1296-3p	PAR-CLIP	23592263
MIRT475364	hsa-miR-194-3p	PAR-CLIP	23592263
MIRT475363	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT475362	hsa-miR-8085	PAR-CLIP	23592263
MIRT475361	hsa-miR-3175	PAR-CLIP	23592263
MIRT475360	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT475359	hsa-miR-4792	PAR-CLIP	23592263
MIRT475358	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT475357	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT475356	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT475365	hsa-miR-1296-3p	PAR-CLIP	26701625
MIRT475365	hsa-miR-1296-3p	PAR-CLIP	26701625
MIRT475365	hsa-miR-1296-3p	PAR-CLIP	26701625
MIRT475365	hsa-miR-1296-3p	PAR-CLIP	26701625
MIRT475365	hsa-miR-1296-3p	PAR-CLIP	26701625
MIRT475365	hsa-miR-1296-3p	PAR-CLIP	26701625
MIRT475365	hsa-miR-1296-3p	PAR-CLIP	26701625
MIRT475365	hsa-miR-1296-3p	PAR-CLIP	26701625
MIRT475365	hsa-miR-1296-3p	PAR-CLIP	26701625
MIRT493542	hsa-miR-1343-5p	PAR-CLIP	26701625
MIRT493542	hsa-miR-1343-5p	PAR-CLIP	26701625
MIRT493542	hsa-miR-1343-5p	PAR-CLIP	26701625
MIRT493542	hsa-miR-1343-5p	PAR-CLIP	26701625
MIRT493542	hsa-miR-1343-5p	PAR-CLIP	26701625
MIRT475364	hsa-miR-194-3p	PAR-CLIP	26701625
MIRT475364	hsa-miR-194-3p	PAR-CLIP	26701625
MIRT475364	hsa-miR-194-3p	PAR-CLIP	26701625
MIRT475364	hsa-miR-194-3p	PAR-CLIP	26701625
MIRT475364	hsa-miR-194-3p	PAR-CLIP	26701625
MIRT475364	hsa-miR-194-3p	PAR-CLIP	26701625
MIRT475364	hsa-miR-194-3p	PAR-CLIP	26701625
MIRT475364	hsa-miR-194-3p	PAR-CLIP	26701625
MIRT475364	hsa-miR-194-3p	PAR-CLIP	26701625
MIRT475357	hsa-miR-3150a-3p	PAR-CLIP	26701625
MIRT475357	hsa-miR-3150a-3p	PAR-CLIP	26701625
MIRT475357	hsa-miR-3150a-3p	PAR-CLIP	26701625
MIRT475357	hsa-miR-3150a-3p	PAR-CLIP	26701625
MIRT475357	hsa-miR-3150a-3p	PAR-CLIP	26701625
MIRT475357	hsa-miR-3150a-3p	PAR-CLIP	26701625
MIRT475357	hsa-miR-3150a-3p	PAR-CLIP	26701625
MIRT475357	hsa-miR-3150a-3p	PAR-CLIP	26701625
MIRT475361	hsa-miR-3175	PAR-CLIP	26701625
MIRT475361	hsa-miR-3175	PAR-CLIP	26701625
MIRT475361	hsa-miR-3175	PAR-CLIP	26701625
MIRT475361	hsa-miR-3175	PAR-CLIP	26701625
MIRT475361	hsa-miR-3175	PAR-CLIP	26701625
MIRT475361	hsa-miR-3175	PAR-CLIP	26701625
MIRT475361	hsa-miR-3175	PAR-CLIP	26701625
MIRT475361	hsa-miR-3175	PAR-CLIP	26701625
MIRT475361	hsa-miR-3175	PAR-CLIP	26701625
MIRT716790	hsa-miR-4733-3p	PAR-CLIP	26701625
MIRT716790	hsa-miR-4733-3p	PAR-CLIP	26701625
MIRT475367	hsa-miR-4781-5p	PAR-CLIP	26701625
MIRT475367	hsa-miR-4781-5p	PAR-CLIP	26701625
MIRT475367	hsa-miR-4781-5p	PAR-CLIP	26701625
MIRT475367	hsa-miR-4781-5p	PAR-CLIP	26701625
MIRT475367	hsa-miR-4781-5p	PAR-CLIP	26701625
MIRT475367	hsa-miR-4781-5p	PAR-CLIP	26701625
MIRT475367	hsa-miR-4781-5p	PAR-CLIP	26701625
MIRT475367	hsa-miR-4781-5p	PAR-CLIP	26701625
MIRT475367	hsa-miR-4781-5p	PAR-CLIP	26701625
MIRT475359	hsa-miR-4792	PAR-CLIP	26701625
MIRT475359	hsa-miR-4792	PAR-CLIP	26701625
MIRT475359	hsa-miR-4792	PAR-CLIP	26701625
MIRT475359	hsa-miR-4792	PAR-CLIP	26701625
MIRT475359	hsa-miR-4792	PAR-CLIP	26701625
MIRT475359	hsa-miR-4792	PAR-CLIP	26701625
MIRT475359	hsa-miR-4792	PAR-CLIP	26701625
MIRT475359	hsa-miR-4792	PAR-CLIP	26701625
MIRT475359	hsa-miR-4792	PAR-CLIP	26701625
MIRT475358	hsa-miR-491-5p	PAR-CLIP	26701625
MIRT475358	hsa-miR-491-5p	PAR-CLIP	26701625
MIRT475358	hsa-miR-491-5p	PAR-CLIP	26701625
MIRT475358	hsa-miR-491-5p	PAR-CLIP	26701625
MIRT475358	hsa-miR-491-5p	PAR-CLIP	26701625
MIRT475358	hsa-miR-491-5p	PAR-CLIP	26701625
MIRT475358	hsa-miR-491-5p	PAR-CLIP	26701625
MIRT475358	hsa-miR-491-5p	PAR-CLIP	26701625
MIRT475358	hsa-miR-491-5p	PAR-CLIP	26701625
MIRT475363	hsa-miR-6731-5p	PAR-CLIP	26701625
MIRT475363	hsa-miR-6731-5p	PAR-CLIP	26701625
MIRT475363	hsa-miR-6731-5p	PAR-CLIP	26701625
MIRT475363	hsa-miR-6731-5p	PAR-CLIP	26701625
MIRT475363	hsa-miR-6731-5p	PAR-CLIP	26701625
MIRT475363	hsa-miR-6731-5p	PAR-CLIP	26701625
MIRT475363	hsa-miR-6731-5p	PAR-CLIP	26701625
MIRT475363	hsa-miR-6731-5p	PAR-CLIP	26701625
MIRT475363	hsa-miR-6731-5p	PAR-CLIP	26701625
MIRT475356	hsa-miR-6763-5p	PAR-CLIP	26701625
MIRT475356	hsa-miR-6763-5p	PAR-CLIP	26701625
MIRT475356	hsa-miR-6763-5p	PAR-CLIP	26701625
MIRT475356	hsa-miR-6763-5p	PAR-CLIP	26701625
MIRT475356	hsa-miR-6763-5p	PAR-CLIP	26701625
MIRT475356	hsa-miR-6763-5p	PAR-CLIP	26701625
MIRT475356	hsa-miR-6763-5p	PAR-CLIP	26701625
MIRT475356	hsa-miR-6763-5p	PAR-CLIP	26701625
MIRT475360	hsa-miR-6825-5p	PAR-CLIP	26701625
MIRT475360	hsa-miR-6825-5p	PAR-CLIP	26701625
MIRT475360	hsa-miR-6825-5p	PAR-CLIP	26701625
MIRT475360	hsa-miR-6825-5p	PAR-CLIP	26701625
MIRT475360	hsa-miR-6825-5p	PAR-CLIP	26701625
MIRT475360	hsa-miR-6825-5p	PAR-CLIP	26701625
MIRT475360	hsa-miR-6825-5p	PAR-CLIP	26701625
MIRT475360	hsa-miR-6825-5p	PAR-CLIP	26701625
MIRT475360	hsa-miR-6825-5p	PAR-CLIP	26701625
MIRT475362	hsa-miR-8085	PAR-CLIP	26701625
MIRT475362	hsa-miR-8085	PAR-CLIP	26701625
MIRT475362	hsa-miR-8085	PAR-CLIP	26701625
MIRT475362	hsa-miR-8085	PAR-CLIP	26701625
MIRT475362	hsa-miR-8085	PAR-CLIP	26701625
MIRT475362	hsa-miR-8085	PAR-CLIP	26701625
MIRT475362	hsa-miR-8085	PAR-CLIP	26701625
MIRT475362	hsa-miR-8085	PAR-CLIP	26701625
MIRT475362	hsa-miR-8085	PAR-CLIP	26701625
MIRT493541	hsa-miR-939-5p	PAR-CLIP	26701625
MIRT493541	hsa-miR-939-5p	PAR-CLIP	26701625
MIRT493541	hsa-miR-939-5p	PAR-CLIP	26701625
MIRT493541	hsa-miR-939-5p	PAR-CLIP	26701625
MIRT493541	hsa-miR-939-5p	PAR-CLIP	26701625
MIRT672838	hsa-miR-129-5p	HITS-CLIP	27418678
MIRT716789	hsa-miR-6769a-3p	HITS-CLIP	19536157
MIRT716790	hsa-miR-4733-3p	HITS-CLIP	19536157
MIRT716788	hsa-miR-4459	HITS-CLIP	19536157
MIRT716787	hsa-miR-665	HITS-CLIP	19536157
MIRT716786	hsa-miR-6841-3p	HITS-CLIP	19536157
MIRT716785	hsa-miR-671-5p	HITS-CLIP	19536157
MIRT716784	hsa-miR-766-5p	HITS-CLIP	19536157
MIRT716783	hsa-miR-6511b-5p	HITS-CLIP	19536157
MIRT716782	hsa-miR-6811-5p	HITS-CLIP	19536157
MIRT691265	hsa-miR-548c-3p	HITS-CLIP	23313552
MIRT691264	hsa-miR-7849-3p	HITS-CLIP	23313552
MIRT691263	hsa-miR-619-3p	HITS-CLIP	23313552
MIRT691262	hsa-miR-7851-3p	HITS-CLIP	23313552
MIRT691261	hsa-miR-4666a-3p	HITS-CLIP	23313552
MIRT691260	hsa-miR-4275	HITS-CLIP	23313552
MIRT691259	hsa-miR-339-5p	HITS-CLIP	23313552
MIRT691258	hsa-miR-4421	HITS-CLIP	23313552
MIRT691257	hsa-miR-5699-3p	HITS-CLIP	23313552
MIRT691256	hsa-miR-6895-3p	HITS-CLIP	23313552
MIRT691255	hsa-miR-593-3p	HITS-CLIP	23313552
MIRT691254	hsa-miR-4684-5p	HITS-CLIP	23313552
MIRT691253	hsa-miR-6818-3p	HITS-CLIP	23313552
MIRT672851	hsa-miR-500b-3p	HITS-CLIP	23824327
MIRT672850	hsa-miR-6773-3p	HITS-CLIP	23824327
MIRT672849	hsa-miR-215-3p	HITS-CLIP	23824327
MIRT672848	hsa-miR-924	HITS-CLIP	23824327
MIRT672847	hsa-miR-3194-3p	HITS-CLIP	23824327
MIRT672846	hsa-miR-4294	HITS-CLIP	23824327
MIRT672845	hsa-miR-6879-3p	HITS-CLIP	23824327
MIRT672844	hsa-miR-431-5p	HITS-CLIP	23824327
MIRT672843	hsa-miR-3672	HITS-CLIP	23824327
MIRT672842	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT672841	hsa-miR-5691	HITS-CLIP	23824327
MIRT672840	hsa-miR-6805-3p	HITS-CLIP	23824327
MIRT672839	hsa-miR-8055	HITS-CLIP	23824327
MIRT672838	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT657255	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT657255	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT657254	hsa-miR-5193	HITS-CLIP	23824327
MIRT657253	hsa-miR-937-5p	HITS-CLIP	23824327
MIRT657252	hsa-miR-627-5p	HITS-CLIP	23824327
MIRT657251	hsa-miR-4273	HITS-CLIP	23824327
MIRT657250	hsa-miR-7156-5p	HITS-CLIP	23824327
MIRT657249	hsa-miR-4677-5p	HITS-CLIP	23824327
MIRT657247	hsa-miR-8081	HITS-CLIP	23824327
MIRT657248	hsa-miR-375	HITS-CLIP	23824327
MIRT657246	hsa-miR-6739-3p	HITS-CLIP	23824327
MIRT475367	hsa-miR-4781-5p	PAR-CLIP	20371350
MIRT475365	hsa-miR-1296-3p	PAR-CLIP	20371350
MIRT475364	hsa-miR-194-3p	PAR-CLIP	20371350
MIRT475363	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT475362	hsa-miR-8085	PAR-CLIP	20371350
MIRT475361	hsa-miR-3175	PAR-CLIP	20371350
MIRT493542	hsa-miR-1343-5p	PAR-CLIP	20371350
MIRT493541	hsa-miR-939-5p	PAR-CLIP	20371350
MIRT475360	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT475359	hsa-miR-4792	PAR-CLIP	20371350
MIRT475358	hsa-miR-491-5p	PAR-CLIP	20371350
MIRT475357	hsa-miR-3150a-3p	PAR-CLIP	20371350
MIRT475356	hsa-miR-6763-5p	PAR-CLIP	20371350
MIRT475367	hsa-miR-4781-5p	PAR-CLIP	20371350
MIRT475365	hsa-miR-1296-3p	PAR-CLIP	20371350
MIRT475364	hsa-miR-194-3p	PAR-CLIP	20371350
MIRT475363	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT475362	hsa-miR-8085	PAR-CLIP	20371350
MIRT475361	hsa-miR-3175	PAR-CLIP	20371350
MIRT493542	hsa-miR-1343-5p	PAR-CLIP	20371350
MIRT493541	hsa-miR-939-5p	PAR-CLIP	20371350
MIRT475360	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT475359	hsa-miR-4792	PAR-CLIP	20371350
MIRT475358	hsa-miR-491-5p	PAR-CLIP	20371350
MIRT475357	hsa-miR-3150a-3p	PAR-CLIP	20371350
MIRT475356	hsa-miR-6763-5p	PAR-CLIP	20371350
MIRT475367	hsa-miR-4781-5p	PAR-CLIP	20371350
MIRT475365	hsa-miR-1296-3p	PAR-CLIP	20371350
MIRT475364	hsa-miR-194-3p	PAR-CLIP	20371350
MIRT475363	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT475362	hsa-miR-8085	PAR-CLIP	20371350
MIRT475361	hsa-miR-3175	PAR-CLIP	20371350
MIRT493542	hsa-miR-1343-5p	PAR-CLIP	20371350
MIRT493541	hsa-miR-939-5p	PAR-CLIP	20371350
MIRT475360	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT475359	hsa-miR-4792	PAR-CLIP	20371350
MIRT475358	hsa-miR-491-5p	PAR-CLIP	20371350
MIRT475357	hsa-miR-3150a-3p	PAR-CLIP	20371350
MIRT475356	hsa-miR-6763-5p	PAR-CLIP	20371350
MIRT475367	hsa-miR-4781-5p	PAR-CLIP	20371350
MIRT475365	hsa-miR-1296-3p	PAR-CLIP	20371350
MIRT475364	hsa-miR-194-3p	PAR-CLIP	20371350
MIRT475363	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT475362	hsa-miR-8085	PAR-CLIP	20371350
MIRT475361	hsa-miR-3175	PAR-CLIP	20371350
MIRT493542	hsa-miR-1343-5p	PAR-CLIP	20371350
MIRT493541	hsa-miR-939-5p	PAR-CLIP	20371350
MIRT475360	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT475359	hsa-miR-4792	PAR-CLIP	20371350
MIRT475358	hsa-miR-491-5p	PAR-CLIP	20371350
MIRT475357	hsa-miR-3150a-3p	PAR-CLIP	20371350
MIRT475356	hsa-miR-6763-5p	PAR-CLIP	20371350
MIRT527242	hsa-miR-548ae-3p	PAR-CLIP	22012620
MIRT527241	hsa-miR-548ah-3p	PAR-CLIP	22012620
MIRT527240	hsa-miR-548aj-3p	PAR-CLIP	22012620
MIRT527239	hsa-miR-548am-3p	PAR-CLIP	22012620
MIRT527238	hsa-miR-548aq-3p	PAR-CLIP	22012620
MIRT527237	hsa-miR-548j-3p	PAR-CLIP	22012620
MIRT527236	hsa-miR-548x-3p	PAR-CLIP	22012620
MIRT527235	hsa-miR-490-3p	PAR-CLIP	22012620
MIRT527234	hsa-miR-649	PAR-CLIP	22012620
MIRT527233	hsa-miR-618	PAR-CLIP	22012620
MIRT527231	hsa-miR-4714-5p	PAR-CLIP	22012620
MIRT527232	hsa-miR-146a-3p	PAR-CLIP	22012620
MIRT475367	hsa-miR-4781-5p	PAR-CLIP	23592263
MIRT475365	hsa-miR-1296-3p	PAR-CLIP	23592263
MIRT475364	hsa-miR-194-3p	PAR-CLIP	23592263
MIRT493545	hsa-miR-3160-3p	PAR-CLIP	23592263
MIRT493544	hsa-miR-558	PAR-CLIP	23592263
MIRT493543	hsa-miR-4487	PAR-CLIP	23592263
MIRT475363	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT475362	hsa-miR-8085	PAR-CLIP	23592263
MIRT475361	hsa-miR-3175	PAR-CLIP	23592263
MIRT493542	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT493541	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT475360	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT475359	hsa-miR-4792	PAR-CLIP	23592263
MIRT475358	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT475357	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT475356	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT475367	hsa-miR-4781-5p	PAR-CLIP	23592263
MIRT475365	hsa-miR-1296-3p	PAR-CLIP	23592263
MIRT475364	hsa-miR-194-3p	PAR-CLIP	23592263
MIRT475363	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT475362	hsa-miR-8085	PAR-CLIP	23592263
MIRT475361	hsa-miR-3175	PAR-CLIP	23592263
MIRT475360	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT475359	hsa-miR-4792	PAR-CLIP	23592263
MIRT475358	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT475357	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT475356	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT475393	hsa-miR-3154	PAR-CLIP	23592263
MIRT475392	hsa-miR-1197	PAR-CLIP	23592263
MIRT475391	hsa-miR-4779	PAR-CLIP	23592263
MIRT475389	hsa-miR-1321	PAR-CLIP	23592263
MIRT475390	hsa-miR-4739	PAR-CLIP	23592263
MIRT475388	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT475387	hsa-miR-6755-5p	PAR-CLIP	23592263
MIRT475386	hsa-miR-3927-3p	PAR-CLIP	23592263
MIRT475385	hsa-miR-6831-5p	PAR-CLIP	23592263
MIRT475384	hsa-miR-7515	PAR-CLIP	23592263
MIRT475383	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT475382	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT475381	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT475380	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT475379	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT475378	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT475377	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT475376	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT475375	hsa-miR-4458	PAR-CLIP	23592263
MIRT475374	hsa-miR-4500	PAR-CLIP	23592263
MIRT475373	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT475372	hsa-miR-7-5p	PAR-CLIP	23592263
MIRT475371	hsa-miR-765	PAR-CLIP	23592263
MIRT475370	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT475368	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT475369	hsa-miR-4650-3p	PAR-CLIP	23592263
MIRT475366	hsa-miR-6780a-5p	PAR-CLIP	23592263
MIRT475367	hsa-miR-4781-5p	PAR-CLIP	23592263
MIRT475365	hsa-miR-1296-3p	PAR-CLIP	23592263
MIRT475364	hsa-miR-194-3p	PAR-CLIP	23592263
MIRT475363	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT475362	hsa-miR-8085	PAR-CLIP	23592263
MIRT475361	hsa-miR-3175	PAR-CLIP	23592263
MIRT475360	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT475359	hsa-miR-4792	PAR-CLIP	23592263
MIRT475358	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT475357	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT475356	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT1058900	hsa-miR-1	CLIP-seq
MIRT1058901	hsa-miR-105	CLIP-seq
MIRT1058902	hsa-miR-1226	CLIP-seq
MIRT1058903	hsa-miR-128	CLIP-seq
MIRT1058904	hsa-miR-1972	CLIP-seq
MIRT1058905	hsa-miR-206	CLIP-seq
MIRT1058906	hsa-miR-2277-3p	CLIP-seq
MIRT1058907	hsa-miR-24	CLIP-seq
MIRT1058908	hsa-miR-298	CLIP-seq
MIRT1058909	hsa-miR-340	CLIP-seq
MIRT1058910	hsa-miR-342-3p	CLIP-seq
MIRT1058911	hsa-miR-3591-3p	CLIP-seq
MIRT1058912	hsa-miR-3618	CLIP-seq
MIRT1058913	hsa-miR-3657	CLIP-seq
MIRT1058914	hsa-miR-3678-3p	CLIP-seq
MIRT1058915	hsa-miR-4284	CLIP-seq
MIRT1058916	hsa-miR-4292	CLIP-seq
MIRT1058917	hsa-miR-4314	CLIP-seq
MIRT1058918	hsa-miR-4320	CLIP-seq
MIRT1058919	hsa-miR-4449	CLIP-seq
MIRT1058920	hsa-miR-4450	CLIP-seq
MIRT1058921	hsa-miR-450b-5p	CLIP-seq
MIRT1058922	hsa-miR-4512	CLIP-seq
MIRT1058923	hsa-miR-4640-5p	CLIP-seq
MIRT1058924	hsa-miR-4646-5p	CLIP-seq
MIRT1058925	hsa-miR-4669	CLIP-seq
MIRT1058926	hsa-miR-4719	CLIP-seq
MIRT1058927	hsa-miR-4725-5p	CLIP-seq
MIRT1058928	hsa-miR-4726-5p	CLIP-seq
MIRT1058929	hsa-miR-4740-3p	CLIP-seq
MIRT1058930	hsa-miR-4755-3p	CLIP-seq
MIRT1058931	hsa-miR-486-3p	CLIP-seq
MIRT1058932	hsa-miR-488	CLIP-seq
MIRT1058933	hsa-miR-504	CLIP-seq
MIRT1058934	hsa-miR-507	CLIP-seq
MIRT1058935	hsa-miR-5095	CLIP-seq
MIRT1058936	hsa-miR-5096	CLIP-seq
MIRT1058937	hsa-miR-542-3p	CLIP-seq
MIRT1058938	hsa-miR-557	CLIP-seq
MIRT1058939	hsa-miR-576-5p	CLIP-seq
MIRT1058940	hsa-miR-613	CLIP-seq
MIRT1058941	hsa-miR-626	CLIP-seq
MIRT1058942	hsa-miR-934	CLIP-seq
MIRT2013698	hsa-miR-103b	CLIP-seq
MIRT2013699	hsa-miR-1252	CLIP-seq
MIRT2013700	hsa-miR-1273f	CLIP-seq
MIRT2013701	hsa-miR-1281	CLIP-seq
MIRT2013702	hsa-miR-1299	CLIP-seq
MIRT2013703	hsa-miR-141	CLIP-seq
MIRT2013704	hsa-miR-1587	CLIP-seq
MIRT2013705	hsa-miR-15a	CLIP-seq
MIRT2013706	hsa-miR-15b	CLIP-seq
MIRT2013707	hsa-miR-16	CLIP-seq
MIRT2013708	hsa-miR-184	CLIP-seq
MIRT2013709	hsa-miR-1910	CLIP-seq
MIRT2013710	hsa-miR-1914	CLIP-seq
MIRT2013711	hsa-miR-195	CLIP-seq
MIRT1058904	hsa-miR-1972	CLIP-seq
MIRT2013712	hsa-miR-200a	CLIP-seq
MIRT1058906	hsa-miR-2277-3p	CLIP-seq
MIRT2013713	hsa-miR-3138	CLIP-seq
MIRT2013714	hsa-miR-3145-5p	CLIP-seq
MIRT2013715	hsa-miR-3166	CLIP-seq
MIRT2013716	hsa-miR-3184	CLIP-seq
MIRT2013717	hsa-miR-320a	CLIP-seq
MIRT2013718	hsa-miR-320b	CLIP-seq
MIRT2013719	hsa-miR-320c	CLIP-seq
MIRT2013720	hsa-miR-320d	CLIP-seq
MIRT2013721	hsa-miR-320e	CLIP-seq
MIRT2013722	hsa-miR-326	CLIP-seq
MIRT2013723	hsa-miR-330-5p	CLIP-seq
MIRT2013724	hsa-miR-331-3p	CLIP-seq
MIRT2013725	hsa-miR-3614-3p	CLIP-seq
MIRT1058912	hsa-miR-3618	CLIP-seq
MIRT2013726	hsa-miR-3651	CLIP-seq
MIRT1058913	hsa-miR-3657	CLIP-seq
MIRT2013727	hsa-miR-3692	CLIP-seq
MIRT2013728	hsa-miR-3911	CLIP-seq
MIRT2013729	hsa-miR-3943	CLIP-seq
MIRT2013730	hsa-miR-423-5p	CLIP-seq
MIRT2013731	hsa-miR-424	CLIP-seq
MIRT2013732	hsa-miR-4264	CLIP-seq
MIRT2013733	hsa-miR-4268	CLIP-seq
MIRT2013734	hsa-miR-4283	CLIP-seq
MIRT2013735	hsa-miR-4289	CLIP-seq
MIRT1058916	hsa-miR-4292	CLIP-seq
MIRT2013736	hsa-miR-4299	CLIP-seq
MIRT1058917	hsa-miR-4314	CLIP-seq
MIRT2013737	hsa-miR-4323	CLIP-seq
MIRT2013738	hsa-miR-4429	CLIP-seq
MIRT1058919	hsa-miR-4449	CLIP-seq
MIRT1058920	hsa-miR-4450	CLIP-seq
MIRT2013739	hsa-miR-4469	CLIP-seq
MIRT2013740	hsa-miR-4481	CLIP-seq
MIRT2013741	hsa-miR-4489	CLIP-seq
MIRT2013742	hsa-miR-4492	CLIP-seq
MIRT2013743	hsa-miR-4496	CLIP-seq
MIRT2013744	hsa-miR-4498	CLIP-seq
MIRT1058921	hsa-miR-450b-5p	CLIP-seq
MIRT2013745	hsa-miR-4530	CLIP-seq
MIRT2013746	hsa-miR-4532	CLIP-seq
MIRT2013747	hsa-miR-455-3p	CLIP-seq
MIRT1058923	hsa-miR-4640-5p	CLIP-seq
MIRT2013748	hsa-miR-4641	CLIP-seq
MIRT2013749	hsa-miR-4643	CLIP-seq
MIRT2013750	hsa-miR-4656	CLIP-seq
MIRT1058925	hsa-miR-4669	CLIP-seq
MIRT2013751	hsa-miR-4675	CLIP-seq
MIRT2013752	hsa-miR-4687-3p	CLIP-seq
MIRT2013753	hsa-miR-4688	CLIP-seq
MIRT1058927	hsa-miR-4725-5p	CLIP-seq
MIRT1058928	hsa-miR-4726-5p	CLIP-seq
MIRT2013754	hsa-miR-4731-5p	CLIP-seq
MIRT1058929	hsa-miR-4740-3p	CLIP-seq
MIRT2013755	hsa-miR-4741	CLIP-seq
MIRT2013756	hsa-miR-4745-5p	CLIP-seq
MIRT1058930	hsa-miR-4755-3p	CLIP-seq
MIRT2013757	hsa-miR-4758-5p	CLIP-seq
MIRT2013758	hsa-miR-4782-5p	CLIP-seq
MIRT2013759	hsa-miR-4800-5p	CLIP-seq
MIRT2013760	hsa-miR-4804-5p	CLIP-seq
MIRT1058931	hsa-miR-486-3p	CLIP-seq
MIRT2013761	hsa-miR-497	CLIP-seq
MIRT1058933	hsa-miR-504	CLIP-seq
MIRT1058934	hsa-miR-507	CLIP-seq
MIRT2013762	hsa-miR-508-5p	CLIP-seq
MIRT1058935	hsa-miR-5095	CLIP-seq
MIRT2013763	hsa-miR-516b	CLIP-seq
MIRT1058937	hsa-miR-542-3p	CLIP-seq
MIRT1058938	hsa-miR-557	CLIP-seq
MIRT2013764	hsa-miR-606	CLIP-seq
MIRT1058941	hsa-miR-626	CLIP-seq
MIRT2013765	hsa-miR-627	CLIP-seq
MIRT2013766	hsa-miR-642a	CLIP-seq
MIRT2013767	hsa-miR-762	CLIP-seq
MIRT1058942	hsa-miR-934	CLIP-seq
MIRT2013768	hsa-miR-939	CLIP-seq
MIRT1058900	hsa-miR-1	CLIP-seq
MIRT2245800	hsa-miR-1207-5p	CLIP-seq
MIRT1058903	hsa-miR-128	CLIP-seq
MIRT2245801	hsa-miR-1293	CLIP-seq
MIRT2245802	hsa-miR-140-3p	CLIP-seq
MIRT2013704	hsa-miR-1587	CLIP-seq
MIRT2013708	hsa-miR-184	CLIP-seq
MIRT1058905	hsa-miR-206	CLIP-seq
MIRT2245803	hsa-miR-2110	CLIP-seq
MIRT2245804	hsa-miR-27a	CLIP-seq
MIRT2245805	hsa-miR-27b	CLIP-seq
MIRT2245806	hsa-miR-3125	CLIP-seq
MIRT2245807	hsa-miR-3127-5p	CLIP-seq
MIRT2245808	hsa-miR-3128	CLIP-seq
MIRT2013713	hsa-miR-3138	CLIP-seq
MIRT2245809	hsa-miR-3144-5p	CLIP-seq
MIRT2245810	hsa-miR-3147	CLIP-seq
MIRT2245811	hsa-miR-3151	CLIP-seq
MIRT2245812	hsa-miR-3182	CLIP-seq
MIRT2013716	hsa-miR-3184	CLIP-seq
MIRT2245813	hsa-miR-3191	CLIP-seq
MIRT1058912	hsa-miR-3618	CLIP-seq
MIRT2013728	hsa-miR-3911	CLIP-seq
MIRT2245814	hsa-miR-3916	CLIP-seq
MIRT2245815	hsa-miR-3918	CLIP-seq
MIRT2013730	hsa-miR-423-5p	CLIP-seq
MIRT2013733	hsa-miR-4268	CLIP-seq
MIRT2013734	hsa-miR-4283	CLIP-seq
MIRT1058916	hsa-miR-4292	CLIP-seq
MIRT1058917	hsa-miR-4314	CLIP-seq
MIRT2245816	hsa-miR-4425	CLIP-seq
MIRT2245817	hsa-miR-4447	CLIP-seq
MIRT1058920	hsa-miR-4450	CLIP-seq
MIRT2245818	hsa-miR-4470	CLIP-seq
MIRT2245819	hsa-miR-4472	CLIP-seq
MIRT2245820	hsa-miR-4483	CLIP-seq
MIRT2245821	hsa-miR-4488	CLIP-seq
MIRT2013741	hsa-miR-4489	CLIP-seq
MIRT2013742	hsa-miR-4492	CLIP-seq
MIRT2245822	hsa-miR-4497	CLIP-seq
MIRT2013744	hsa-miR-4498	CLIP-seq
MIRT2245823	hsa-miR-4651	CLIP-seq
MIRT2245824	hsa-miR-4652-5p	CLIP-seq
MIRT2013750	hsa-miR-4656	CLIP-seq
MIRT2245825	hsa-miR-4659a-3p	CLIP-seq
MIRT2245826	hsa-miR-4659b-3p	CLIP-seq
MIRT2245827	hsa-miR-4663	CLIP-seq
MIRT2245828	hsa-miR-4674	CLIP-seq
MIRT2013751	hsa-miR-4675	CLIP-seq
MIRT2013753	hsa-miR-4688	CLIP-seq
MIRT2245829	hsa-miR-4697-5p	CLIP-seq
MIRT2245830	hsa-miR-4704-3p	CLIP-seq
MIRT2245831	hsa-miR-4720-5p	CLIP-seq
MIRT2245832	hsa-miR-4736	CLIP-seq
MIRT2013755	hsa-miR-4741	CLIP-seq
MIRT2245833	hsa-miR-4763-3p	CLIP-seq
MIRT2245834	hsa-miR-4781-3p	CLIP-seq
MIRT2245835	hsa-miR-4786-3p	CLIP-seq
MIRT2245836	hsa-miR-4799-3p	CLIP-seq
MIRT2013759	hsa-miR-4800-5p	CLIP-seq
MIRT2013760	hsa-miR-4804-5p	CLIP-seq
MIRT1058931	hsa-miR-486-3p	CLIP-seq
MIRT1058935	hsa-miR-5095	CLIP-seq
MIRT2245837	hsa-miR-513a-5p	CLIP-seq
MIRT2245838	hsa-miR-541	CLIP-seq
MIRT2245839	hsa-miR-583	CLIP-seq
MIRT2013764	hsa-miR-606	CLIP-seq
MIRT2245840	hsa-miR-608	CLIP-seq
MIRT1058940	hsa-miR-613	CLIP-seq
MIRT2245841	hsa-miR-617	CLIP-seq
MIRT2245842	hsa-miR-654-5p	CLIP-seq
MIRT2013767	hsa-miR-762	CLIP-seq
MIRT1058942	hsa-miR-934	CLIP-seq
MIRT2245843	hsa-miR-940	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001817	Process	Regulation of cytokine production	IBA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	TAS	11429535
GO:0005515	Function	Protein binding	IPI	11956294, 16951355
GO:0005886	Component	Plasma membrane	IDA	11007762
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006952	Process	Defense response	NAS	11983910
GO:0006972	Process	Hyperosmotic response	NAS	12145647
GO:0007165	Process	Signal transduction	NAS	12145647
GO:0009897	Component	External side of plasma membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	12145647
GO:0042104	Process	Positive regulation of activated T cell proliferation	IEA
GO:0042104	Process	Positive regulation of activated T cell proliferation	TAS	11429535
GO:0042110	Process	T cell activation	NAS	11983910
GO:0042113	Process	B cell activation	IEA
GO:0042802	Function	Identical protein binding	IPI	16951355
GO:0048018	Function	Receptor ligand activity	IDA	33033255
GO:0050852	Process	T cell receptor signaling pathway	IBA
GO:0061470	Process	T follicular helper cell differentiation	IDA	27135603, 30523347
GO:0061470	Process	T follicular helper cell differentiation	IDA	24411167
GO:0070062	Component	Extracellular exosome	HDA	23533145

Other IDs

• MIM: 605717
• HGNC: 17087
• e!Ensembl: ENSG00000160223

Protein

• UniProt ID: O75144
• Protein name: ICOS ligand (B7 homolog 2) (B7-H2) (B7-like protein Gl50) (B7-related protein 1) (B7RP-1) (CD antigen CD275)
• Protein function: Ligand for the T-cell-specific cell surface receptor ICOS. Acts as a costimulatory signal for T-cell proliferation and cytokine secretion (PubMed:11007762, PubMed:11023515, PubMed:30498080). Also induces B-cell proliferation and differentiation
• PDB: 6X4G, 6X4T
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	20 → 133	Immunoglobulin V-set domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed on peripheral blood B-cells and monocytes, as well as on monocyte-derived dendritic cells (at protein level). {ECO:0000269|PubMed:10779774, ECO:0000269|PubMed:11007762, ECO:0000269|PubMed:11023515}.; TISSUE SPECIFICITY: [Isof
• Sequence:

  MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESK
  TVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSL
  GFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLL
  DQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERD
  KITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTG
  HV

• Sequence length: 302

Pathways

KEGG:

Cell adhesion molecules
Intestinal immune network for IgA production

Reactome:

Costimulation by the CD28 family

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Combined immunodeficiency	Likely pathogenic	rs2146342598	RCV001824255	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CELIAC DISEASE	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LEFT-SIDED ULCERATIVE COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS, ULCERATIVE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMBINED IMMUNODEFICIENCY DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immunodeficiency 119	Uncertain significance	ClinVar ClinVar, Disgenet, GenCC, HPO ClinVar, Disgenet, GenCC, HPO ClinVar, Disgenet, GenCC, HPO	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alopecia	Alopecia	BEFREE	23196741		★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	23196741		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	29513931		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	17323353	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	GWASDB_DG	21150878		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	24661627, 25769613, 28810548		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	GWASDB_DG	21383967		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	26560438	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30789152		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31143539		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31292534	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30942404	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	20976171	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	35675627	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24885059	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	GWASCAT_DG	20190752		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	CTD_human_DG	20190752		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	GWASDB_DG	20190752		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	Pubtator	20190752	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis Ulcerative	Ulcerative colitis	Pubtator	20176734	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	20140740, 29505962		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29414642		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	15358621, 15507387		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	20176734, 23707475, 24837102, 26084578		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	20176734, 22929019, 24837102	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	31090221		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	30575933	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	20176734		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	27896820, 30575933		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	27166175		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	31090221		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	15728513		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	32792357	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	14603470		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	14603470		★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	35116032	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	17212709		★☆☆☆☆ Found in Text Mining only
Hypogammaglobulinemia	Hypogammaglobulinemia	BEFREE	25406581		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	GWASDB_DG	21383967		★☆☆☆☆ Found in Text Mining only
Immunoglobulin A deficiency (disorder)	Immunoglobulin A deficiency	BEFREE	31445098		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	BEFREE	15047591		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	37525248	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	23175469	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	23175469, 30500073	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	16115907, 30319662		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	16115907		★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	Pubtator	31545280	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30942404, 31485608, 31545280		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37850501	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	15476242	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	22969819	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	29513931, 31500130		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	LHGDN	12960306		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23688438		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30219366		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	20140740, 29505962		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21098714		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	33051240	Inhibit	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	39596506	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	34289871	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	21248470, 22666318	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	12864987		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	22190364		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	31374257		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	37414259	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	27565576	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	31998801	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21098714, 29414642		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35624419	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35675627	Inhibit	★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	31153660		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	26084578		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12784384, 30789152		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	24390342		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASCAT_DG	30423114		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoidosis	Sarcoidosis	BEFREE	26415669		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	40298889	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32548602	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36983005	Inhibit	★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	31529720		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23688438		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12800259	Stimulate	★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	23196741		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	29030005		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	26560438		★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	17212709		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	20176734, 22592522		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	CTD_human_DG	20228799		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vascular Diseases	Vascular disease	Pubtator	30575933	Associate	★☆☆☆☆ Found in Text Mining only