FMO5 (flavin containing dimethylaniline monoxygenase 5)

Gene

• Entrez ID: 2330
• Gene name: Flavin containing dimethylaniline monoxygenase 5
• Gene symbol: FMO5
• Synonyms (NCBI Gene): hBVMO1
• Chromosome: 1
• Chromosome location: 1q21.1
• Summary: Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT999749	hsa-miR-155	CLIP-seq
MIRT999750	hsa-miR-3148	CLIP-seq
MIRT999751	hsa-miR-3609	CLIP-seq
MIRT999752	hsa-miR-3914	CLIP-seq
MIRT999753	hsa-miR-4496	CLIP-seq
MIRT999754	hsa-miR-4753-3p	CLIP-seq
MIRT999755	hsa-miR-4768-5p	CLIP-seq
MIRT999756	hsa-miR-548ah	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004497	Function	Monooxygenase activity	IDA	20947616, 26771671, 28783300
GO:0004497	Function	Monooxygenase activity	IEA
GO:0004499	Function	N,N-dimethylaniline monooxygenase activity	IBA
GO:0004499	Function	N,N-dimethylaniline monooxygenase activity	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006805	Process	Xenobiotic metabolic process	IDA	20947616, 28783300
GO:0006805	Process	Xenobiotic metabolic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0016174	Function	NAD(P)H oxidase H2O2-forming activity	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0050660	Function	Flavin adenine dinucleotide binding	IEA
GO:0050661	Function	NADP binding	IEA
GO:0090181	Process	Regulation of cholesterol metabolic process	IEA
GO:0090181	Process	Regulation of cholesterol metabolic process	ISS

Other IDs

• MIM: 603957
• HGNC: 3773
• e!Ensembl: ENSG00000131781

Protein

• UniProt ID: P49326
• Protein name: Flavin-containing monooxygenase 5 (FMO 5) (Baeyer-Villiger monooxygenase 1) (hBVMO1) (EC 1.14.13.-) (Dimethylaniline monooxygenase [N-oxide-forming] 5) (EC 1.14.13.8) (Dimethylaniline oxidase 5) (NADPH oxidase) (EC 1.6.3.1)
• Protein function: Acts as a Baeyer-Villiger monooxygenase on a broad range of substrates. Catalyzes the insertion of an oxygen atom into a carbon-carbon bond adjacent to a carbonyl, which converts ketones to esters (PubMed:20947616, PubMed:26771671, PubMed:287833
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00743	FMO-like	3 → 533	Flavin-binding monooxygenase-like	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in fetal and adult liver. {ECO:0000269|PubMed:7872795, ECO:0000305|PubMed:20947616}.
• Sequence:

  MTKKRIAVIGGGVSGLSSIKCCVEEGLEPVCFERTDDIGGLWRFQENPEEGRASIYKSVI
  INTSKEMMCFSDYPIPDHYPNFMHNAQVLEYFRMYAKEFDLLKYIRFKTTVCSVKKQPDF
  ATSGQWEVVTESEGKKEMNVFDGVMVCTGHHTNAHLPLESFPGIEKFKGQYFHSRDYKNP
  EGFTGKRVIIIGIGNSGGDLAVEISQTAKQVFLSTRRGAWILNRVGDYGYPADVLFSSRL
  THFIWKICGQSLANKYLEKKINQRFDHEMFGLKPKHRALSQHPTLNDDLPNRIISGLVKV
  KGNVKEFTETAAIFEDGSREDDIDAVIFATGYSFDFPFLEDSVKVVKNKISLYKKVFPPN
  LERPTLAIIGLIQPLGAIMPISELQGRWATQVFKGLKTLPSQSEMMAEISKAQEEIDKRY
  VESQRHTIQGDYIDTMEELADLVGVRPNLLSLAFTDPKLALHLLLGPCTPIHYRVQGPGK
  WDGARKAILTTDDRIRKPLMTRVVERSSSMTSTMTIGKFMLALAFFAIIIAYF

• Sequence length: 533

Pathways

KEGG:

Taurine and hypotaurine metabolism
Drug metabolism - cytochrome P450
Metabolic pathways

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CONGENITAL HEART DISEASE	—	ClinGen, Disgenet ClinGen, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	BEFREE	15084249		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15084249	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29456741		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29456741		★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	22318994	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15084249		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29456741		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29456741		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	28963451		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15084249		★☆☆☆☆ Found in Text Mining only