WWC1 (WW and C2 domain containing 1)

Gene

• Entrez ID: 23286
• Gene name: WW and C2 domain containing 1
• Gene symbol: WWC1
• Synonyms (NCBI Gene): HBEBP3, HBEBP36, KIBRA, MEMRYQTL, PPP1R168
• Chromosome: 5
• Chromosome location: 5q34
• Summary: The protein encoded by this gene is a cytoplasmic phosphoprotein that interacts with PRKC-zeta and dynein light chain-1. Alleles of this gene have been found that enhance memory in some individuals. Three transcript variants encoding different isoforms ha

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019952	hsa-miR-375	Microarray	20215506
MIRT020928	hsa-miR-155-5p	Reporter assay;Other	20584899
MIRT724407	hsa-miR-562	HITS-CLIP	19536157
MIRT724406	hsa-miR-5697	HITS-CLIP	19536157
MIRT724405	hsa-miR-212-5p	HITS-CLIP	19536157
MIRT724404	hsa-miR-548s	HITS-CLIP	19536157
MIRT724403	hsa-miR-4701-5p	HITS-CLIP	19536157
MIRT724402	hsa-miR-588	HITS-CLIP	19536157
MIRT724401	hsa-miR-4435	HITS-CLIP	19536157
MIRT724400	hsa-miR-3187-3p	HITS-CLIP	19536157
MIRT724399	hsa-miR-498	HITS-CLIP	19536157
MIRT686302	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT686301	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT686300	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT686299	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT686298	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT686297	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT686296	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT686295	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT686294	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT686293	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT686292	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT686291	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT686290	hsa-miR-302e	HITS-CLIP	23313552
MIRT686289	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT686288	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT686287	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT686286	hsa-miR-520b	HITS-CLIP	23313552
MIRT686285	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT686284	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT686283	hsa-miR-520e	HITS-CLIP	23313552
MIRT686282	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT686281	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT686280	hsa-miR-520h	HITS-CLIP	23313552
MIRT686279	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT686278	hsa-miR-150-5p	HITS-CLIP	23313552
MIRT686277	hsa-miR-1913	HITS-CLIP	23313552
MIRT686276	hsa-miR-324-3p	HITS-CLIP	23313552
MIRT686275	hsa-miR-18a-3p	HITS-CLIP	23313552
MIRT686274	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT686273	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT533137	hsa-miR-4707-3p	HITS-CLIP	23313552
MIRT686272	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT686271	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT686270	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT686269	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT675587	hsa-miR-6796-3p	HITS-CLIP	23824327
MIRT675586	hsa-miR-216a-5p	HITS-CLIP	23824327
MIRT675585	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT675584	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT675583	hsa-miR-5693	HITS-CLIP	23824327
MIRT675582	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT675581	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT675580	hsa-miR-2276-3p	HITS-CLIP	23824327
MIRT675579	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT675578	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT675577	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT675576	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT675575	hsa-miR-891a-3p	HITS-CLIP	23824327
MIRT675574	hsa-miR-5001-3p	HITS-CLIP	23824327
MIRT675573	hsa-miR-5698	HITS-CLIP	23824327
MIRT533138	hsa-miR-22-3p	PAR-CLIP	22012620
MIRT533136	hsa-miR-4258	PAR-CLIP	22012620
MIRT533137	hsa-miR-4707-3p	PAR-CLIP	22012620
MIRT020928	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT020928	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT724407	hsa-miR-562	HITS-CLIP	19536157
MIRT724406	hsa-miR-5697	HITS-CLIP	19536157
MIRT724405	hsa-miR-212-5p	HITS-CLIP	19536157
MIRT724404	hsa-miR-548s	HITS-CLIP	19536157
MIRT724403	hsa-miR-4701-5p	HITS-CLIP	19536157
MIRT724402	hsa-miR-588	HITS-CLIP	19536157
MIRT724401	hsa-miR-4435	HITS-CLIP	19536157
MIRT724400	hsa-miR-3187-3p	HITS-CLIP	19536157
MIRT724399	hsa-miR-498	HITS-CLIP	19536157
MIRT686302	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT686301	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT686300	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT686299	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT686298	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT686297	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT686296	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT686295	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT686294	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT686293	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT686292	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT686291	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT686290	hsa-miR-302e	HITS-CLIP	23313552
MIRT686289	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT686288	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT686287	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT686286	hsa-miR-520b	HITS-CLIP	23313552
MIRT686285	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT686284	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT686283	hsa-miR-520e	HITS-CLIP	23313552
MIRT686282	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT686281	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT686280	hsa-miR-520h	HITS-CLIP	23313552
MIRT686279	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT686278	hsa-miR-150-5p	HITS-CLIP	23313552
MIRT686277	hsa-miR-1913	HITS-CLIP	23313552
MIRT686276	hsa-miR-324-3p	HITS-CLIP	23313552
MIRT686275	hsa-miR-18a-3p	HITS-CLIP	23313552
MIRT686274	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT686273	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT533137	hsa-miR-4707-3p	HITS-CLIP	23313552
MIRT686272	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT686271	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT686270	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT686269	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT675587	hsa-miR-6796-3p	HITS-CLIP	23824327
MIRT675586	hsa-miR-216a-5p	HITS-CLIP	23824327
MIRT675585	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT675584	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT675583	hsa-miR-5693	HITS-CLIP	23824327
MIRT675582	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT675581	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT675580	hsa-miR-2276-3p	HITS-CLIP	23824327
MIRT675579	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT675578	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT675577	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT675576	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT675575	hsa-miR-891a-3p	HITS-CLIP	23824327
MIRT675574	hsa-miR-5001-3p	HITS-CLIP	23824327
MIRT675573	hsa-miR-5698	HITS-CLIP	23824327
MIRT533138	hsa-miR-22-3p	PAR-CLIP	22012620
MIRT533136	hsa-miR-4258	PAR-CLIP	22012620
MIRT533137	hsa-miR-4707-3p	PAR-CLIP	22012620
MIRT1494594	hsa-miR-1231	CLIP-seq
MIRT1494595	hsa-miR-1273f	CLIP-seq
MIRT1494596	hsa-miR-1284	CLIP-seq
MIRT1494597	hsa-miR-129-5p	CLIP-seq
MIRT1494598	hsa-miR-138	CLIP-seq
MIRT1494599	hsa-miR-143	CLIP-seq
MIRT1494600	hsa-miR-155	CLIP-seq
MIRT1494601	hsa-miR-219-5p	CLIP-seq
MIRT1494602	hsa-miR-300	CLIP-seq
MIRT1494603	hsa-miR-346	CLIP-seq
MIRT1494604	hsa-miR-381	CLIP-seq
MIRT1494605	hsa-miR-3920	CLIP-seq
MIRT1494606	hsa-miR-4288	CLIP-seq
MIRT1494607	hsa-miR-4445	CLIP-seq
MIRT1494608	hsa-miR-4633-3p	CLIP-seq
MIRT1494609	hsa-miR-4652-3p	CLIP-seq
MIRT1494610	hsa-miR-4662a-5p	CLIP-seq
MIRT1494611	hsa-miR-4666-3p	CLIP-seq
MIRT1494612	hsa-miR-4708-5p	CLIP-seq
MIRT1494613	hsa-miR-4718	CLIP-seq
MIRT1494614	hsa-miR-4738-3p	CLIP-seq
MIRT1494615	hsa-miR-4762-3p	CLIP-seq
MIRT1494616	hsa-miR-4770	CLIP-seq
MIRT1494617	hsa-miR-4782-3p	CLIP-seq
MIRT1494618	hsa-miR-4795-3p	CLIP-seq
MIRT1494619	hsa-miR-508-3p	CLIP-seq
MIRT1494620	hsa-miR-617	CLIP-seq
MIRT1494621	hsa-miR-632	CLIP-seq
MIRT1494622	hsa-miR-1270	CLIP-seq
MIRT1494602	hsa-miR-300	CLIP-seq
MIRT1494623	hsa-miR-3134	CLIP-seq
MIRT1494624	hsa-miR-3691-5p	CLIP-seq
MIRT1494604	hsa-miR-381	CLIP-seq
MIRT1494625	hsa-miR-4427	CLIP-seq
MIRT1494626	hsa-miR-4459	CLIP-seq
MIRT1494627	hsa-miR-4534	CLIP-seq
MIRT1494628	hsa-miR-4653-3p	CLIP-seq
MIRT1494611	hsa-miR-4666-3p	CLIP-seq
MIRT1494629	hsa-miR-4680-3p	CLIP-seq
MIRT1494630	hsa-miR-4683	CLIP-seq
MIRT1494631	hsa-miR-4709-5p	CLIP-seq
MIRT1494632	hsa-miR-4716-5p	CLIP-seq
MIRT1494633	hsa-miR-4717-5p	CLIP-seq
MIRT1494634	hsa-miR-4753-5p	CLIP-seq
MIRT1494635	hsa-miR-4790-3p	CLIP-seq
MIRT1494636	hsa-miR-483-3p	CLIP-seq
MIRT1494637	hsa-miR-488	CLIP-seq
MIRT1494638	hsa-miR-501-3p	CLIP-seq
MIRT1494639	hsa-miR-502-3p	CLIP-seq
MIRT1494640	hsa-miR-548a-3p	CLIP-seq
MIRT1494641	hsa-miR-548e	CLIP-seq
MIRT1494642	hsa-miR-548f	CLIP-seq
MIRT1494643	hsa-miR-577	CLIP-seq
MIRT1494644	hsa-miR-620	CLIP-seq
MIRT1494645	hsa-miR-711	CLIP-seq
MIRT1494595	hsa-miR-1273f	CLIP-seq
MIRT1494597	hsa-miR-129-5p	CLIP-seq
MIRT1494599	hsa-miR-143	CLIP-seq
MIRT1494646	hsa-miR-1915	CLIP-seq
MIRT1494647	hsa-miR-192	CLIP-seq
MIRT1494648	hsa-miR-215	CLIP-seq
MIRT1494649	hsa-miR-216a	CLIP-seq
MIRT1494650	hsa-miR-2276	CLIP-seq
MIRT1494651	hsa-miR-2467-3p	CLIP-seq
MIRT1494652	hsa-miR-27a	CLIP-seq
MIRT1494653	hsa-miR-27b	CLIP-seq
MIRT1494654	hsa-miR-3121-5p	CLIP-seq
MIRT1494655	hsa-miR-3124-3p	CLIP-seq
MIRT1494656	hsa-miR-3144-5p	CLIP-seq
MIRT1494657	hsa-miR-3160-5p	CLIP-seq
MIRT1494658	hsa-miR-3191	CLIP-seq
MIRT1494659	hsa-miR-3194-3p	CLIP-seq
MIRT1494660	hsa-miR-323-5p	CLIP-seq
MIRT1494661	hsa-miR-3591-3p	CLIP-seq
MIRT1494662	hsa-miR-3665	CLIP-seq
MIRT1494663	hsa-miR-4257	CLIP-seq
MIRT1494664	hsa-miR-4297	CLIP-seq
MIRT1494665	hsa-miR-4527	CLIP-seq
MIRT1494627	hsa-miR-4534	CLIP-seq
MIRT1494666	hsa-miR-4652-5p	CLIP-seq
MIRT1494628	hsa-miR-4653-3p	CLIP-seq
MIRT1494610	hsa-miR-4662a-5p	CLIP-seq
MIRT1494667	hsa-miR-4667-5p	CLIP-seq
MIRT1494668	hsa-miR-4686	CLIP-seq
MIRT1494669	hsa-miR-4697-3p	CLIP-seq
MIRT1494670	hsa-miR-4700-5p	CLIP-seq
MIRT1494612	hsa-miR-4708-5p	CLIP-seq
MIRT1494671	hsa-miR-4713-5p	CLIP-seq
MIRT1494672	hsa-miR-4726-3p	CLIP-seq
MIRT1494616	hsa-miR-4770	CLIP-seq
MIRT1494618	hsa-miR-4795-3p	CLIP-seq
MIRT1494636	hsa-miR-483-3p	CLIP-seq
MIRT1494673	hsa-miR-513a-5p	CLIP-seq
MIRT1494674	hsa-miR-563	CLIP-seq
MIRT1494675	hsa-miR-657	CLIP-seq
MIRT1494627	hsa-miR-4534	CLIP-seq
MIRT2148976	hsa-miR-3613-3p	CLIP-seq
MIRT2148977	hsa-miR-4786-5p	CLIP-seq
MIRT2369407	hsa-miR-103a	CLIP-seq
MIRT2369408	hsa-miR-107	CLIP-seq
MIRT2369409	hsa-miR-122	CLIP-seq
MIRT2369410	hsa-miR-1281	CLIP-seq
MIRT2369411	hsa-miR-1285	CLIP-seq
MIRT1494597	hsa-miR-129-5p	CLIP-seq
MIRT2369412	hsa-miR-1307	CLIP-seq
MIRT2369413	hsa-miR-1343	CLIP-seq
MIRT2369414	hsa-miR-139-3p	CLIP-seq
MIRT2369415	hsa-miR-15a	CLIP-seq
MIRT2369416	hsa-miR-15b	CLIP-seq
MIRT2369417	hsa-miR-16	CLIP-seq
MIRT1494646	hsa-miR-1915	CLIP-seq
MIRT2369418	hsa-miR-195	CLIP-seq
MIRT1494649	hsa-miR-216a	CLIP-seq
MIRT1494650	hsa-miR-2276	CLIP-seq
MIRT2369419	hsa-miR-2278	CLIP-seq
MIRT2369420	hsa-miR-2355-5p	CLIP-seq
MIRT1494652	hsa-miR-27a	CLIP-seq
MIRT1494653	hsa-miR-27b	CLIP-seq
MIRT2369421	hsa-miR-3135b	CLIP-seq
MIRT2369422	hsa-miR-3152-3p	CLIP-seq
MIRT2369423	hsa-miR-3187-5p	CLIP-seq
MIRT1494659	hsa-miR-3194-3p	CLIP-seq
MIRT2369424	hsa-miR-3200-5p	CLIP-seq
MIRT2369425	hsa-miR-3652	CLIP-seq
MIRT2369426	hsa-miR-3653	CLIP-seq
MIRT2369427	hsa-miR-3658	CLIP-seq
MIRT2369428	hsa-miR-3672	CLIP-seq
MIRT2369429	hsa-miR-3677-5p	CLIP-seq
MIRT1494624	hsa-miR-3691-5p	CLIP-seq
MIRT2369430	hsa-miR-3945	CLIP-seq
MIRT2369431	hsa-miR-411	CLIP-seq
MIRT2369432	hsa-miR-424	CLIP-seq
MIRT2369433	hsa-miR-4251	CLIP-seq
MIRT2369434	hsa-miR-4253	CLIP-seq
MIRT2369435	hsa-miR-4269	CLIP-seq
MIRT2369436	hsa-miR-4284	CLIP-seq
MIRT2369437	hsa-miR-4286	CLIP-seq
MIRT2369438	hsa-miR-4290	CLIP-seq
MIRT2369439	hsa-miR-4294	CLIP-seq
MIRT2369440	hsa-miR-431	CLIP-seq
MIRT2369441	hsa-miR-4329	CLIP-seq
MIRT2369442	hsa-miR-4420	CLIP-seq
MIRT1494625	hsa-miR-4427	CLIP-seq
MIRT2369443	hsa-miR-4428	CLIP-seq
MIRT2369444	hsa-miR-4430	CLIP-seq
MIRT1494626	hsa-miR-4459	CLIP-seq
MIRT2369445	hsa-miR-4460	CLIP-seq
MIRT2369446	hsa-miR-4514	CLIP-seq
MIRT2369447	hsa-miR-4638-5p	CLIP-seq
MIRT1494610	hsa-miR-4662a-5p	CLIP-seq
MIRT2369448	hsa-miR-4676-5p	CLIP-seq
MIRT1494629	hsa-miR-4680-3p	CLIP-seq
MIRT2369449	hsa-miR-4687-5p	CLIP-seq
MIRT2369450	hsa-miR-4692	CLIP-seq
MIRT1494669	hsa-miR-4697-3p	CLIP-seq
MIRT2369451	hsa-miR-4722-5p	CLIP-seq
MIRT1494672	hsa-miR-4726-3p	CLIP-seq
MIRT2369452	hsa-miR-4727-3p	CLIP-seq
MIRT2369453	hsa-miR-4742-5p	CLIP-seq
MIRT2369454	hsa-miR-4778-3p	CLIP-seq
MIRT2148977	hsa-miR-4786-5p	CLIP-seq
MIRT2369455	hsa-miR-4797-5p	CLIP-seq
MIRT2369456	hsa-miR-497	CLIP-seq
MIRT1494638	hsa-miR-501-3p	CLIP-seq
MIRT1494639	hsa-miR-502-3p	CLIP-seq
MIRT2369457	hsa-miR-5096	CLIP-seq
MIRT1494673	hsa-miR-513a-5p	CLIP-seq
MIRT2369458	hsa-miR-575	CLIP-seq
MIRT2369459	hsa-miR-612	CLIP-seq
MIRT2369460	hsa-miR-769-5p	CLIP-seq
MIRT2369461	hsa-miR-924	CLIP-seq
MIRT2369462	hsa-miR-940	CLIP-seq
MIRT1494646	hsa-miR-1915	CLIP-seq
MIRT2463580	hsa-miR-2681	CLIP-seq
MIRT1494659	hsa-miR-3194-3p	CLIP-seq
MIRT2463581	hsa-miR-4436b-3p	CLIP-seq
MIRT1494672	hsa-miR-4726-3p	CLIP-seq
MIRT2463582	hsa-miR-615-5p	CLIP-seq
MIRT2463580	hsa-miR-2681	CLIP-seq
MIRT2463581	hsa-miR-4436b-3p	CLIP-seq
MIRT2463582	hsa-miR-615-5p	CLIP-seq
MIRT1494646	hsa-miR-1915	CLIP-seq
MIRT2663057	hsa-miR-1976	CLIP-seq
MIRT1494659	hsa-miR-3194-3p	CLIP-seq
MIRT2663058	hsa-miR-4279	CLIP-seq
MIRT1494626	hsa-miR-4459	CLIP-seq
MIRT2663059	hsa-miR-4722-3p	CLIP-seq
MIRT2369451	hsa-miR-4722-5p	CLIP-seq
MIRT1494672	hsa-miR-4726-3p	CLIP-seq
MIRT2663060	hsa-miR-4786-3p	CLIP-seq
MIRT2663061	hsa-miR-486-3p	CLIP-seq
MIRT2663062	hsa-miR-671-5p	CLIP-seq
MIRT1494597	hsa-miR-129-5p	CLIP-seq
MIRT2695316	hsa-miR-4735-5p	CLIP-seq
MIRT2695317	hsa-miR-4775	CLIP-seq
MIRT2695318	hsa-miR-590-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
TCF7L2	Unknown	24072042

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	24682284
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0003713	Function	Transcription coactivator activity	IDA	16684779
GO:0005515	Function	Protein binding	IPI	16684779, 17994011, 18190796, 18596123, 19885391
GO:0005634	Component	Nucleus	IDA	16684779, 18190796
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	35429439
GO:0005737	Component	Cytoplasm	IDA	16684779, 18190796
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	24682284
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	24682284
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IBA
GO:0016477	Process	Cell migration	IDA	18596123
GO:0019900	Function	Kinase binding	IBA
GO:0019900	Function	Kinase binding	IPI	24682284
GO:0030010	Process	Establishment of cell polarity	TAS	24682284
GO:0032587	Component	Ruffle membrane	IDA	18190796
GO:0032587	Component	Ruffle membrane	IEA
GO:0035329	Process	Hippo signaling	IDA	15688006, 18328708, 35429439
GO:0035329	Process	Hippo signaling	IDA	35429439
GO:0035329	Process	Hippo signaling	IEA
GO:0035330	Process	Regulation of hippo signaling	IBA
GO:0035330	Process	Regulation of hippo signaling	IMP	20159598
GO:0035331	Process	Negative regulation of hippo signaling	IDA	24682284
GO:0035331	Process	Negative regulation of hippo signaling	IEA
GO:0035332	Process	Positive regulation of hippo signaling	IDA	11118213
GO:0035591	Function	Signaling adaptor activity	IDA	35429439
GO:0035591	Function	Signaling adaptor activity	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	18190796
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0046621	Process	Negative regulation of organ growth	IBA
GO:0046621	Process	Negative regulation of organ growth	IEA
GO:0046621	Process	Negative regulation of organ growth	IMP	24682284
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	18596123
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0060090	Function	Molecular adaptor activity	IBA
GO:0060090	Function	Molecular adaptor activity	IDA	24682284

Other IDs

• MIM: 610533
• HGNC: 29435
• e!Ensembl: ENSG00000113645

Protein

• UniProt ID: Q8IX03
• Protein name: Protein KIBRA (HBeAg-binding protein 3) (Kidney and brain protein) (KIBRA) (WW domain-containing protein 1)
• Protein function: Regulator of the Hippo signaling pathway, also known as the Salvador-Warts-Hippo (SWH) pathway (PubMed:24682284). Enhances phosphorylation of LATS1 and YAP1 and negatively regulates cell proliferation and organ growth due to a suppression of the
• PDB: 2Z0U, 6FB4, 6FD0, 6FJC, 6FJD
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00397	WW	8 → 37	WW domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in mammary epithelial cells and breast cancer cell lines. Found in the luminal epithelium surrounding the ducts in the normal breast. In the brain, expressed in somatodendritic compartment of neurons in the cortex and hippoca
• Sequence:

  MPRPELPLPEGWEEARDFDGKVYYIDHTNRTTSWIDPRDRYTKPLTFADCISDELPLGWE
  EAYDPQVGDYFIDHNTKTTQIEDPRVQWRREQEHMLKDYLVVAQEALSAQKEIYQVKQQR
  LELAQQEYQQLHAVWEHKLGSQVSLVSGSSSSSKYDPEILKAEIATAKSRVNKLKREMVH
  LQHELQFKERGFQTLKKIDKKMSDAQGSYKLDEAQAVLRETKAIKKAITCGEKEKQDLIK
  SLAMLKDGFRTDRGSHSDLWSSSSSLESSSFPLPKQYLDVSSQTDISGSFGINSNNQLAE
  KVRLRLRYEEAKRRIANLKIQLAKLDSEAWPGVLDSERDRLILINEKEELLKEMRFISPR
  KWTQGEVEQLEMARKRLEKDLQAARDTQSKALTERLKLNSKRNQLVRELEEATRQVATLH
  SQLKSLSSSMQSLSSGSSPGSLTSSRGSLVASSLDSSTSASFTDLYYDPFEQLDSELQSK
  VEFLLLEGATGFRPSGCITTIHEDEVAKTQKAEGGGRLQALRSLSGTPKSMTSLSPRSSL
  SSPSPPCSPLMADPLLAGDAFLNSLEFEDPELSATLCELSLGNSAQERYRLEEPGTEGKQ
  LGQAVNTAQGCGLKVACVSAAVSDESVAGDSGVYEASVQRLGASEAAAFDSDESEAVGAT
  RIQIALKYDEKNKQFAILIIQLSNLSALLQQQDQKVNIRVAVLPCSESTTCLFRTRPLDA
  SDTLVFNEVFWVSMSYPALHQKTLRVDVCTTDRSHLEECLGGAQISLAEVCRSGERSTRW
  YNLLSYKYLKKQSRELKPVGVMAPASGPASTDAVSALLEQTAVELEKRQEGRSSTQTLED
  SWRYEETSENEAVAEEEEEEVEEEEGEEDVFTEKASPDMDGYPALKVDKETNTETPAPSP
  TVVRPKDRRVGTPSQGPFLRGSTIIRSKTFSPGPQSQYVCRLNRSDSDSSTLSKKPPFVR
  NSLERRSVRMKRPSSVKSLRSERLIRTSLDLELDLQATRTWHSQLTQEISVLKELKEQLE
  QAKSHGEKELPQWLREDERFRLLLRMLEKRQMDRAEHKGELQTDKMMRAAAKDVHRLRGQ
  SCKEPPEVQSFREKMAFFTRPRMNIPALSADDV

• Sequence length: 1113

Pathways

KEGG:

Hippo signaling pathway
Hippo signaling pathway - multiple species

Reactome:

Signaling by Hippo
NOTCH3 Intracellular Domain Regulates Transcription

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALIGNANT EPITHELIAL TUMOR OF OVARY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Memory quantitative trait locus	association	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONORGANIC PSYCHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30372890		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	18789830, 21185624, 23778582, 28380666, 29391469, 30134813, 30201328, 35599479, 36669907	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease	Alzheimer disease	Pubtator	28380666	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	18789830, 28380666		★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	27041503		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	23926262	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	28495464		★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	29391469	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	GWASDB_DG	23041938		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22614006, 28664913, 29793439, 29873413, 30042827, 30121333, 30977035, 31102318		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16684779, 29793439, 29873413, 34441043	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31102318	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21878642, 27220053, 29046731, 29523820	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	31469419	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	29046731	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31469419		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	21173572		★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	28056976	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	22430796		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	29391469	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32016966	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29046731		★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	Pubtator	35017578	Inhibit	★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	Pubtator	35017578	Associate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	18194457, 25080189, 30134813		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	LHGDN	18194457		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	30134813, 30706571	Associate	★☆☆☆☆ Found in Text Mining only
Dementia Vascular	Vascular dementia	Pubtator	36669907	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	21943600		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	26768155		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	26768155	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epithelial ovarian cancer	Ovarian cancer	BEFREE	31469419		★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	30784589		★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	34441043	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	21346737	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	21346737		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29391469, 30706571, 30953258		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	21173572		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	BEFREE	30372890		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	28056976	Associate	★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	25756049		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22614006, 28664913, 29793439, 29873413, 30042827, 30121333, 30977035, 31102318		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27220053, 29017577		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23163744, 29659170		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21173572, 24072042, 28664913, 29523820, 29659170, 31102318		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16684779		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	28664913		★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory disorders	Pubtator	21185624	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	21943600		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	26768155		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mild cognitive disorder	Cognitive disorder	BEFREE	18194457, 30953258		★☆☆☆☆ Found in Text Mining only
Mosaic variegated aneuploidy syndrome	Mosaic variegated aneuploidy	Pubtator	22904328	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21173572, 23163744, 25832504, 27220053, 29046731, 29523820, 29562176, 31102318		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	24072042		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	30201328	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29526515		★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	25146696		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	29555977		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	20185150		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonorganic psychosis	Nonorganic Psychosis	PSYGENET_DG	20185150		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	29873413		★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	30706571		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	23582269, 30134813		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	21173572		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	18194457, 25080189, 30134813		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	28056976		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27220053, 29017577		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	27220053		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27220053	Associate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	20185150		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	PSYGENET_DG	20185150		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	21346737	Associate	★☆☆☆☆ Found in Text Mining only
Recurrent depressive disorder	Mental Depression	BEFREE	26768155		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	26405221		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	26405221	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	31560173		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23163744, 29659170		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29659170	Associate	★☆☆☆☆ Found in Text Mining only
Tourette Syndrome	Tourette syndrome	Pubtator	28472652	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29562176, 30121333, 31102318		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	31102318	Inhibit	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34441043	Associate	★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	25080189		★☆☆☆☆ Found in Text Mining only