Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	23284
Gene name	Adhesion G protein-coupled receptor L3
Gene symbol	ADGRL3
Synonyms (NCBI Gene)	CIRL3CL3LEC3LPHN3
Chromosome	4
Chromosome location	4q13.1
Summary	This gene encodes a member of the latrophilin subfamily of G-protein coupled receptors (GPCR). Latrophilins may function in both cell adhesion and signal transduction. In experiments with non-human species, endogenous proteolytic cleavage within a cystein

Show/Hide all (59)

miRTarBase ID	miRNA	Experiments	Reference
MIRT740396	hsa-miR-7844-5p	HITS-CLIP	19536157
MIRT740397	hsa-miR-5683	HITS-CLIP	19536157
MIRT740398	hsa-miR-1245b-3p	HITS-CLIP	19536157
MIRT740399	hsa-miR-3682-3p	HITS-CLIP	19536157
MIRT740400	hsa-miR-4775	HITS-CLIP	19536157
MIRT741705	hsa-miR-323a-3p	HITS-CLIP	23824327
MIRT741705	hsa-miR-323a-3p	HITS-CLIP	23824327
MIRT741957	hsa-miR-3133	HITS-CLIP	23824327
MIRT741958	hsa-miR-4511	HITS-CLIP	23824327
MIRT741959	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT741960	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT741961	hsa-miR-216a-5p	HITS-CLIP	23824327
MIRT741962	hsa-miR-3976	HITS-CLIP	23824327
MIRT741963	hsa-miR-1285-5p	HITS-CLIP	23824327
MIRT741964	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT741965	hsa-miR-4639-3p	HITS-CLIP	23824327
MIRT741966	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT741967	hsa-miR-6794-3p	HITS-CLIP	23824327
MIRT741968	hsa-miR-526b-5p	HITS-CLIP	23824327
MIRT741969	hsa-miR-578	HITS-CLIP	23824327
MIRT742273	hsa-miR-4282	HITS-CLIP	23824327
MIRT741705	hsa-miR-323a-3p	HITS-CLIP	23824327
MIRT742294	hsa-miR-3606-3p	HITS-CLIP	23824327
MIRT742295	hsa-miR-513a-3p	HITS-CLIP	23824327
MIRT742296	hsa-miR-513c-3p	HITS-CLIP	23824327
MIRT742273	hsa-miR-4282	HITS-CLIP	23824327
MIRT741705	hsa-miR-323a-3p	HITS-CLIP	23824327
MIRT741705	hsa-miR-323a-3p	HITS-CLIP	23824327
MIRT742273	hsa-miR-4282	HITS-CLIP	23824327
MIRT742294	hsa-miR-3606-3p	HITS-CLIP	23824327
MIRT742295	hsa-miR-513a-3p	HITS-CLIP	23824327
MIRT742296	hsa-miR-513c-3p	HITS-CLIP	23824327
MIRT741705	hsa-miR-323a-3p	HITS-CLIP	23824327
MIRT742273	hsa-miR-4282	HITS-CLIP	23824327
MIRT741705	hsa-miR-323a-3p	HITS-CLIP	23824327
MIRT755246	hsa-miR-3668	PAR-CLIP	22100165
MIRT755247	hsa-miR-7852-3p	PAR-CLIP	22100165
MIRT755248	hsa-miR-1253	PAR-CLIP	22100165
MIRT755249	hsa-miR-6770-5p	PAR-CLIP	22100165
MIRT755250	hsa-miR-601	PAR-CLIP	22100165
MIRT755251	hsa-miR-6832-5p	PAR-CLIP	22100165
MIRT755252	hsa-miR-4732-5p	PAR-CLIP	22100165
MIRT755253	hsa-miR-580-3p	PAR-CLIP	22100165
MIRT755254	hsa-miR-6843-3p	PAR-CLIP	22100165
MIRT755255	hsa-miR-6848-3p	PAR-CLIP	22100165
MIRT755256	hsa-miR-133a-3p	PAR-CLIP	22100165
MIRT755257	hsa-miR-133b	PAR-CLIP	22100165
MIRT755246	hsa-miR-3668	PAR-CLIP	22100165
MIRT755247	hsa-miR-7852-3p	PAR-CLIP	22100165
MIRT755248	hsa-miR-1253	PAR-CLIP	22100165
MIRT755249	hsa-miR-6770-5p	PAR-CLIP	22100165
MIRT755250	hsa-miR-601	PAR-CLIP	22100165
MIRT755251	hsa-miR-6832-5p	PAR-CLIP	22100165
MIRT755252	hsa-miR-4732-5p	PAR-CLIP	22100165
MIRT755253	hsa-miR-580-3p	PAR-CLIP	22100165
MIRT755254	hsa-miR-6843-3p	PAR-CLIP	22100165
MIRT755255	hsa-miR-6848-3p	PAR-CLIP	22100165
MIRT755256	hsa-miR-133a-3p	PAR-CLIP	22100165
MIRT755257	hsa-miR-133b	PAR-CLIP	22100165

Show/Hide all (46)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001764	Process	Neuron migration	ISS
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IDA	35418682
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	ISS
GO:0004930	Function	G protein-coupled receptor activity	NAS	10994649
GO:0004930	Function	G protein-coupled receptor activity	TAS	15203201
GO:0005509	Function	Calcium ion binding	IDA	26235030
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	26235030
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	26235030
GO:0005886	Component	Plasma membrane	IEA
GO:0005911	Component	Cell-cell junction	IBA
GO:0005911	Component	Cell-cell junction	ISS
GO:0007155	Process	Cell adhesion	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	NAS	10994649
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	15203201
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	ISS
GO:0007416	Process	Synapse assembly	IBA
GO:0007416	Process	Synapse assembly	ISS
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	10994649
GO:0016020	Component	Membrane	TAS	15203201
GO:0030246	Function	Carbohydrate binding	IEA
GO:0030424	Component	Axon	IBA
GO:0030424	Component	Axon	IEA
GO:0030424	Component	Axon	ISS
GO:0042995	Component	Cell projection	IEA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:0098631	Function	Cell adhesion mediator activity	ISS
GO:0098742	Process	Cell-cell adhesion via plasma-membrane adhesion molecules	IBA
GO:0098742	Process	Cell-cell adhesion via plasma-membrane adhesion molecules	IDA	26235030
GO:0098742	Process	Cell-cell adhesion via plasma-membrane adhesion molecules	IEA
GO:0098978	Component	Glutamatergic synapse	IBA
GO:0140693	Function	Molecular condensate scaffold activity	ISS
GO:0160221	Process	Rho-activating G protein-coupled receptor signaling pathway	IDA	35418682
GO:1904861	Process	Excitatory synapse assembly	ISS

MIM	HGNC	e!Ensembl
616417	20974	ENSG00000150471

Q9HAR2

Protein name

Adhesion G protein-coupled receptor L3 (Calcium-independent alpha-latrotoxin receptor 3) (CIRL-3) (Latrophilin-3) (Lectomedin-3)

Protein function

Orphan adhesion G-protein coupled receptor (aGPCR), which mediates synapse specificity (PubMed:35418682). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the

PDB

5CMN , 6VHH , 7SF7 , 8DJG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02140	Gal_Lectin	43 → 123	Galactose binding lectin domain	Domain
PF02191	OLF	139 → 391	Olfactomedin-like domain	Family
PF16489	GAIN	567 → 775	GPCR-Autoproteolysis INducing (GAIN) domain	Domain
PF01825	GPS	803 → 847	GPCR proteolysis site, GPS, motif	Motif
PF00002	7tm_2	861 → 1097	7 transmembrane receptor (Secretin family)	Family
PF02354	Latrophilin	1117 → 1184	Latrophilin Cytoplasmic C-terminal region	Family
PF02354	Latrophilin	1181 → 1447	Latrophilin Cytoplasmic C-terminal region	Family

Sequence

MWPSQLLIFMMLLAPIIHAFSRAPIPMAVVRRELSCESYPIELRCPGTDVIMIESANYGR
TDDKICDSDPAQMENIRCYLPDAYKIMSQRCNNRTQCAVVAGPDVFPDPCPGTYKYLEVQ
YECVPYKVEQKVFLCPGLLKGVYQSEHLFESDHQSGAWCKDPLQASDKIYYMPWTPYRTD
TLTEYSSKDDFIAGRPTTTYKLPHRVDGTGFVVYDGALFFNKERTRNIVKFDLRTRIKSG
EAIIANANYHDTSPYRWGGKSDIDLAVDENGLWVIYATEQNNGKIVISQLNPYTLRIEGT
WDTAYDKRSASNAFMICGILYVVKSVYEDDDNEATGNKIDYIYNTDQSKDSLVDVPFPNS
YQYIAAVDYNPRDNLLYVWNNYHVVKYSLDFGPLDSRSGQAHHGQVSYISPPIHLDSELE
RPSVKDISTTGPLGMGSTTTSTTLRTTTLSPGRSTTPSVSGRRNRSTSTPSPAVEVLDDM
TTHLPSASSQIPALEESCEAVEAREIMWFKTRQGQIAKQPCPAGTIGVSTYLCLAPDGIW
DPQGPDLSNCSSPWVNHITQKLKSGETAANIARELAEQTRNHLNAGDITYSVRAMDQLVG
LLDVQLRNLTPGGKDSAARSLNKAMVETVNNLLQPQALNAWRDLTTSDQLRAATMLLHTV
EESAFVLADNLLKTDIVRENTDNIKLEVARLSTEGNLEDLKFPENMGHGSTIQLSANTLK
QNGRNGEIRVAFVLYNNLGPYLSTENASMKLGTEALSTNHSVIVNSPVITAAINKEFSNK
VYLADPVVFTVKHIKQSEENFNPNCSFWSYSKRTMTGYWSTQGCRLLTTNKTHTTCSCNH
LTNFAVLMAHVEVKHSDAVHDLLLDVITWVGILLSLVCLLICIFTFCFFRGLQSDRNTIH
KNLCISLFVAELLFLIGINRTDQPIACAVFAALLHFFFLAAFTWMFLEGVQLYIMLVEVF
ESEHSRRKYFYLVGYGMPALIVAVSAAVDYRSYGTDKVCWLRLDTYFIWSFIGPATLIIM
LNVIFLGIALYKMFHHTAILKPESGCLDNIKSWVIGAIALLCLLGLTWAFGLMYINESTV
IMAYLFTIFNSLQGMFIFIFHCVLQKKVRKEYGKCLRTHCCSGKSTESSIGSGKTSGSRT
PGRYSTGSQSRIRRMWNDTVRKQSESSFITGDINSSASLNREGLLNNARDTSVMDTLPLN
GNHGNSYSIASGEYLSNCVQIIDRGYNHNETALEKKILKELTSNYIPSYLNNHERSSEQN
RNLMNKLVNNLGSGREDDAIVLDDATSFNHEESLGLELIHEESDAPLLPPRVYSTENHQP
HHYTRRRIPQDHSESFFPLLTNEHTEDLQSPHRDSLYTSMPTLAGVAATESVTTSTQTEP
PPAKCGDAEDVYYKSMPNLGSRNHVHQLHTYYQLGRGSSDGFIVPPNKDGTPPEGSSKGP
AHLVTSL

Sequence length

1447

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (17)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT DISORDER WITH HYPERACTIVITY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIC ESOPHAGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENERALISED EPILEPSY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARTIAL EPILEPSY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (33)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Asthma	Asthma	BEFREE	29375702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	27692237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit and Disruptive Behavior Disorders	Attention deficit hyperactivity disorder	Pubtator	30696812	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder	Attention Deficit Hyperactivity Disorder	CTD_human_DG	22405201		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention Deficit Disorder	Attention Deficit Hyperactivity Disorder	BEFREE	25871512		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	20157310, 21040458, 21606926, 22832519, 23190410, 23245769, 25989180, 26598068, 26746237, 27692237, 28624582, 28871191, 30696812, 31426340, 33504901, 35393556, 36151371 View all (2 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	20157310, 21040458, 21184580, 21606926, 22832519, 22851411, 22939004, 23190410, 23245769, 25229170, 25871512, 25989180, 26746237, 27692237, 28624582 View all (6 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	CTD_human_DG	22405201		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	30652248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behavior Disorders	Behavior Disorders	BEFREE	21184580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bicuspid Aortic Valve Disease	Bicuspid aortic valve	Pubtator	21309044	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	30758784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23317273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23317273, 39948777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33247693	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	26718977	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30226566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Class III malocclusion	Malocclusion	BEFREE	28367897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutis Laxa Autosomal Dominant	Cutis laxa	Pubtator	21309044	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	23670970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30726739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disruptive Impulse Control and Conduct Disorders	Disruptive, impulse control, and conduct disorders	Pubtator	28624582	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	Pubtator	23190410	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30226566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	16007110	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29938681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23317273	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23317273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Minimal Brain Dysfunction	Minimal Brain Dysfunction	CTD_human_DG	22405201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30226566		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	Pubtator	27692237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	30652248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	30652248		★★★★★ ★☆☆☆☆ Found in Text Mining only

ADGRL3 (adhesion G protein-coupled receptor L3)