Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	23274
Gene name	C-type lectin domain containing 16A
Gene symbol	CLEC16A
Synonyms (NCBI Gene)	Gop-1KIAA0350
Chromosome	16
Chromosome location	16p13.13
Summary	This gene encodes a member of the C-type lectin domain containing family. Single nucleotide polymorphisms in introns of this gene have been associated with diabetes mellitus, multiple sclerosis and rheumatoid arthritis. Multiple transcript variants encodi

232

Show/Hide all (232)

miRTarBase ID	miRNA	Experiments	Reference
MIRT043317	hsa-miR-331-3p	CLASH	23622248
MIRT041783	hsa-miR-484	CLASH	23622248
MIRT440937	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440937	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT895659	hsa-miR-1178	CLIP-seq
MIRT895660	hsa-miR-1251	CLIP-seq
MIRT895661	hsa-miR-1275	CLIP-seq
MIRT895662	hsa-miR-127-5p	CLIP-seq
MIRT895663	hsa-miR-1302	CLIP-seq
MIRT895664	hsa-miR-1323	CLIP-seq
MIRT895665	hsa-miR-1324	CLIP-seq
MIRT895666	hsa-miR-138	CLIP-seq
MIRT895667	hsa-miR-150	CLIP-seq
MIRT895668	hsa-miR-1587	CLIP-seq
MIRT895669	hsa-miR-1913	CLIP-seq
MIRT895670	hsa-miR-2277-3p	CLIP-seq
MIRT895671	hsa-miR-2467-3p	CLIP-seq
MIRT895672	hsa-miR-2861	CLIP-seq
MIRT895673	hsa-miR-3121-5p	CLIP-seq
MIRT895674	hsa-miR-3126-5p	CLIP-seq
MIRT895675	hsa-miR-3158-3p	CLIP-seq
MIRT895676	hsa-miR-3169	CLIP-seq
MIRT895677	hsa-miR-3184	CLIP-seq
MIRT895678	hsa-miR-3189-5p	CLIP-seq
MIRT895679	hsa-miR-3199	CLIP-seq
MIRT895680	hsa-miR-3202	CLIP-seq
MIRT895681	hsa-miR-324-3p	CLIP-seq
MIRT895682	hsa-miR-3619-3p	CLIP-seq
MIRT895683	hsa-miR-3622a-3p	CLIP-seq
MIRT895684	hsa-miR-3622b-3p	CLIP-seq
MIRT895685	hsa-miR-3652	CLIP-seq
MIRT895686	hsa-miR-3661	CLIP-seq
MIRT895687	hsa-miR-3689d	CLIP-seq
MIRT895688	hsa-miR-370	CLIP-seq
MIRT895689	hsa-miR-378g	CLIP-seq
MIRT895690	hsa-miR-3918	CLIP-seq
MIRT895691	hsa-miR-423-5p	CLIP-seq
MIRT895692	hsa-miR-4263	CLIP-seq
MIRT895693	hsa-miR-4271	CLIP-seq
MIRT895694	hsa-miR-4298	CLIP-seq
MIRT895695	hsa-miR-4430	CLIP-seq
MIRT895696	hsa-miR-4480	CLIP-seq
MIRT895697	hsa-miR-4488	CLIP-seq
MIRT895698	hsa-miR-4492	CLIP-seq
MIRT895699	hsa-miR-4497	CLIP-seq
MIRT895700	hsa-miR-4498	CLIP-seq
MIRT895701	hsa-miR-4502	CLIP-seq
MIRT895702	hsa-miR-4505	CLIP-seq
MIRT895703	hsa-miR-4512	CLIP-seq
MIRT895704	hsa-miR-4515	CLIP-seq
MIRT895705	hsa-miR-4521	CLIP-seq
MIRT895706	hsa-miR-4532	CLIP-seq
MIRT895707	hsa-miR-4640-5p	CLIP-seq
MIRT895708	hsa-miR-4649-3p	CLIP-seq
MIRT895709	hsa-miR-4656	CLIP-seq
MIRT895710	hsa-miR-4665-5p	CLIP-seq
MIRT895711	hsa-miR-4667-3p	CLIP-seq
MIRT895712	hsa-miR-4675	CLIP-seq
MIRT895713	hsa-miR-4684-5p	CLIP-seq
MIRT895714	hsa-miR-4685-5p	CLIP-seq
MIRT895715	hsa-miR-4697-5p	CLIP-seq
MIRT895716	hsa-miR-4698	CLIP-seq
MIRT895717	hsa-miR-4711-3p	CLIP-seq
MIRT895718	hsa-miR-4721	CLIP-seq
MIRT895719	hsa-miR-4725-3p	CLIP-seq
MIRT895720	hsa-miR-4726-5p	CLIP-seq
MIRT895721	hsa-miR-4740-5p	CLIP-seq
MIRT895722	hsa-miR-4741	CLIP-seq
MIRT895723	hsa-miR-4747-5p	CLIP-seq
MIRT895724	hsa-miR-4749-3p	CLIP-seq
MIRT895725	hsa-miR-4758-3p	CLIP-seq
MIRT895726	hsa-miR-4776-5p	CLIP-seq
MIRT895727	hsa-miR-4779	CLIP-seq
MIRT895728	hsa-miR-4786-3p	CLIP-seq
MIRT895729	hsa-miR-4797-5p	CLIP-seq
MIRT895730	hsa-miR-4800-5p	CLIP-seq
MIRT895731	hsa-miR-500a	CLIP-seq
MIRT895732	hsa-miR-513a-3p	CLIP-seq
MIRT895733	hsa-miR-544	CLIP-seq
MIRT895734	hsa-miR-548o	CLIP-seq
MIRT895735	hsa-miR-607	CLIP-seq
MIRT895736	hsa-miR-618	CLIP-seq
MIRT895737	hsa-miR-624	CLIP-seq
MIRT895738	hsa-miR-631	CLIP-seq
MIRT895739	hsa-miR-635	CLIP-seq
MIRT895740	hsa-miR-661	CLIP-seq
MIRT895741	hsa-miR-662	CLIP-seq
MIRT895742	hsa-miR-762	CLIP-seq
MIRT895743	hsa-miR-767-3p	CLIP-seq
MIRT895702	hsa-miR-4505	CLIP-seq
MIRT1965558	hsa-miR-1207-5p	CLIP-seq
MIRT1965559	hsa-miR-1237	CLIP-seq
MIRT1965560	hsa-miR-1248	CLIP-seq
MIRT1965561	hsa-miR-125a-5p	CLIP-seq
MIRT1965562	hsa-miR-125b	CLIP-seq
MIRT1965563	hsa-miR-137	CLIP-seq
MIRT895666	hsa-miR-138	CLIP-seq
MIRT1965564	hsa-miR-145	CLIP-seq
MIRT1965565	hsa-miR-1539	CLIP-seq
MIRT1965566	hsa-miR-1825	CLIP-seq
MIRT1965567	hsa-miR-199a-5p	CLIP-seq
MIRT1965568	hsa-miR-199b-5p	CLIP-seq
MIRT1965569	hsa-miR-205	CLIP-seq
MIRT1965570	hsa-miR-23a	CLIP-seq
MIRT1965571	hsa-miR-23b	CLIP-seq
MIRT1965572	hsa-miR-23c	CLIP-seq
MIRT895671	hsa-miR-2467-3p	CLIP-seq
MIRT1965573	hsa-miR-3074-3p	CLIP-seq
MIRT1965574	hsa-miR-3074-5p	CLIP-seq
MIRT1965575	hsa-miR-3122	CLIP-seq
MIRT1965576	hsa-miR-3144-5p	CLIP-seq
MIRT1965577	hsa-miR-3180-5p	CLIP-seq
MIRT1965578	hsa-miR-3182	CLIP-seq
MIRT1965579	hsa-miR-3183	CLIP-seq
MIRT1965580	hsa-miR-3191	CLIP-seq
MIRT1965581	hsa-miR-3193	CLIP-seq
MIRT1965582	hsa-miR-323-3p	CLIP-seq
MIRT1965583	hsa-miR-326	CLIP-seq
MIRT1965584	hsa-miR-330-5p	CLIP-seq
MIRT1965585	hsa-miR-3591-5p	CLIP-seq
MIRT895683	hsa-miR-3622a-3p	CLIP-seq
MIRT895684	hsa-miR-3622b-3p	CLIP-seq
MIRT1965586	hsa-miR-3647-3p	CLIP-seq
MIRT1965587	hsa-miR-3662	CLIP-seq
MIRT1965588	hsa-miR-3689a-3p	CLIP-seq
MIRT1965589	hsa-miR-3689c	CLIP-seq
MIRT895688	hsa-miR-370	CLIP-seq
MIRT1965590	hsa-miR-3913-3p	CLIP-seq
MIRT1965591	hsa-miR-3913-5p	CLIP-seq
MIRT1965592	hsa-miR-4255	CLIP-seq
MIRT1965593	hsa-miR-4283	CLIP-seq
MIRT1965594	hsa-miR-4319	CLIP-seq
MIRT1965595	hsa-miR-4328	CLIP-seq
MIRT1965596	hsa-miR-4464	CLIP-seq
MIRT1965597	hsa-miR-4476	CLIP-seq
MIRT895696	hsa-miR-4480	CLIP-seq
MIRT1965598	hsa-miR-4489	CLIP-seq
MIRT895698	hsa-miR-4492	CLIP-seq
MIRT895700	hsa-miR-4498	CLIP-seq
MIRT1965599	hsa-miR-4528	CLIP-seq
MIRT895706	hsa-miR-4532	CLIP-seq
MIRT1965600	hsa-miR-4652-5p	CLIP-seq
MIRT1965601	hsa-miR-4659a-3p	CLIP-seq
MIRT1965602	hsa-miR-4659b-3p	CLIP-seq
MIRT1965603	hsa-miR-4660	CLIP-seq
MIRT1965604	hsa-miR-4667-5p	CLIP-seq
MIRT1965605	hsa-miR-4700-5p	CLIP-seq
MIRT1965606	hsa-miR-4701-5p	CLIP-seq
MIRT1965607	hsa-miR-4717-3p	CLIP-seq
MIRT1965608	hsa-miR-4723-3p	CLIP-seq
MIRT1965609	hsa-miR-4732-3p	CLIP-seq
MIRT1965610	hsa-miR-4736	CLIP-seq
MIRT1965611	hsa-miR-4748	CLIP-seq
MIRT1965612	hsa-miR-4763-3p	CLIP-seq
MIRT1965613	hsa-miR-4768-5p	CLIP-seq
MIRT1965614	hsa-miR-4795-3p	CLIP-seq
MIRT1965615	hsa-miR-489	CLIP-seq
MIRT1965616	hsa-miR-5096	CLIP-seq
MIRT895732	hsa-miR-513a-3p	CLIP-seq
MIRT1965617	hsa-miR-556-3p	CLIP-seq
MIRT1965618	hsa-miR-588	CLIP-seq
MIRT895737	hsa-miR-624	CLIP-seq
MIRT1965619	hsa-miR-637	CLIP-seq
MIRT1965620	hsa-miR-665	CLIP-seq
MIRT1965621	hsa-miR-670	CLIP-seq
MIRT895742	hsa-miR-762	CLIP-seq
MIRT1965622	hsa-miR-873	CLIP-seq
MIRT1965623	hsa-miR-942	CLIP-seq
MIRT1965559	hsa-miR-1237	CLIP-seq
MIRT1965560	hsa-miR-1248	CLIP-seq
MIRT895670	hsa-miR-2277-3p	CLIP-seq
MIRT1965570	hsa-miR-23a	CLIP-seq
MIRT1965571	hsa-miR-23b	CLIP-seq
MIRT1965572	hsa-miR-23c	CLIP-seq
MIRT1965574	hsa-miR-3074-5p	CLIP-seq
MIRT1965575	hsa-miR-3122	CLIP-seq
MIRT2201504	hsa-miR-3136-3p	CLIP-seq
MIRT2201505	hsa-miR-330-3p	CLIP-seq
MIRT1965588	hsa-miR-3689a-3p	CLIP-seq
MIRT1965589	hsa-miR-3689c	CLIP-seq
MIRT1965590	hsa-miR-3913-3p	CLIP-seq
MIRT1965591	hsa-miR-3913-5p	CLIP-seq
MIRT1965596	hsa-miR-4464	CLIP-seq
MIRT895717	hsa-miR-4711-3p	CLIP-seq
MIRT1965607	hsa-miR-4717-3p	CLIP-seq
MIRT2201506	hsa-miR-4728-5p	CLIP-seq
MIRT1965611	hsa-miR-4748	CLIP-seq
MIRT895728	hsa-miR-4786-3p	CLIP-seq
MIRT1965615	hsa-miR-489	CLIP-seq
MIRT1965616	hsa-miR-5096	CLIP-seq
MIRT2386170	hsa-miR-3189-3p	CLIP-seq
MIRT895688	hsa-miR-370	CLIP-seq
MIRT2447153	hsa-miR-3915	CLIP-seq
MIRT2447154	hsa-miR-3928	CLIP-seq
MIRT2447155	hsa-miR-4709-3p	CLIP-seq
MIRT2447156	hsa-miR-539	CLIP-seq
MIRT2447153	hsa-miR-3915	CLIP-seq
MIRT2447154	hsa-miR-3928	CLIP-seq
MIRT2447155	hsa-miR-4709-3p	CLIP-seq
MIRT2447156	hsa-miR-539	CLIP-seq
MIRT2504455	hsa-miR-1262	CLIP-seq
MIRT895662	hsa-miR-127-5p	CLIP-seq
MIRT2504456	hsa-miR-1294	CLIP-seq
MIRT895666	hsa-miR-138	CLIP-seq
MIRT895673	hsa-miR-3121-5p	CLIP-seq
MIRT2201504	hsa-miR-3136-3p	CLIP-seq
MIRT1965576	hsa-miR-3144-5p	CLIP-seq
MIRT1965580	hsa-miR-3191	CLIP-seq
MIRT895685	hsa-miR-3652	CLIP-seq
MIRT895686	hsa-miR-3661	CLIP-seq
MIRT2447153	hsa-miR-3915	CLIP-seq
MIRT2447154	hsa-miR-3928	CLIP-seq
MIRT895695	hsa-miR-4430	CLIP-seq
MIRT2504457	hsa-miR-4456	CLIP-seq
MIRT895702	hsa-miR-4505	CLIP-seq
MIRT1965600	hsa-miR-4652-5p	CLIP-seq
MIRT895716	hsa-miR-4698	CLIP-seq
MIRT2504458	hsa-miR-4701-3p	CLIP-seq
MIRT2447155	hsa-miR-4709-3p	CLIP-seq
MIRT2504459	hsa-miR-4710	CLIP-seq
MIRT2504460	hsa-miR-4757-5p	CLIP-seq
MIRT895728	hsa-miR-4786-3p	CLIP-seq
MIRT2504461	hsa-miR-4786-5p	CLIP-seq
MIRT2447156	hsa-miR-539	CLIP-seq
MIRT2504462	hsa-miR-615-5p	CLIP-seq
MIRT895738	hsa-miR-631	CLIP-seq
MIRT2504463	hsa-miR-769-5p	CLIP-seq
MIRT2504464	hsa-miR-938	CLIP-seq
MIRT2447153	hsa-miR-3915	CLIP-seq
MIRT2447154	hsa-miR-3928	CLIP-seq
MIRT2447155	hsa-miR-4709-3p	CLIP-seq
MIRT2447156	hsa-miR-539	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000423	Process	Mitophagy	IDA	35604110
GO:0005515	Function	Protein binding	IPI	36538041
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005768	Component	Endosome	IEA
GO:0005770	Component	Late endosome	IBA
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IDA	28223137
GO:0005829	Component	Cytosol	IDA	28223137
GO:0006914	Process	Autophagy	IEA
GO:0007034	Process	Vacuolar transport	IBA
GO:0009267	Process	Cellular response to starvation	IMP	28223137
GO:0010008	Component	Endosome membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0016197	Process	Endosomal transport	IBA
GO:0031982	Component	Vesicle	IDA	28223137
GO:1901096	Process	Regulation of autophagosome maturation	IBA
GO:1901097	Process	Negative regulation of autophagosome maturation	IMP	28223137
GO:1904263	Process	Positive regulation of TORC1 signaling	IMP	28223137

MIM	HGNC	e!Ensembl
611303	29013	ENSG00000038532

Q2KHT3

Protein name

Protein CLEC16A (C-type lectin domain family 16 member A)

Protein function

Regulator of mitophagy through the upstream regulation of the RNF41/NRDP1-PRKN pathway. Mitophagy is a selective form of autophagy necessary for mitochondrial quality control. The RNF41/NRDP1-PRKN pathway regulates autophagosome-lysosome fusion

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09758	FPL	51 → 198	Uncharacterised conserved protein	Family

Tissue specificity

TISSUE SPECIFICITY: Almost exclusively expressed in immune cells, including dendritic cells, B-lymphocytes and natural killer cells. {ECO:0000269|PubMed:17632545}.

Sequence

MFGRSRSWVGGGHGKTSRNIHSLDHLKYLYHVLTKNTTVTEQNRNLLVETIRSITEILIW
GDQNDSSVFDFFLEKNMFVFFLNILRQKSGRYVCVQLLQTLNILFENISHETSLYYLLSN
NYVNSIIVHKFDFSDEEIMAYYISFLKTLSLKLNNHTVHFFYNEHTNDFALYTEAIKFFN
HPESMVRIAVRTITLNVYKVSLDNQAMLHYIRDKTAVPYFSNLVWFIGSHVIELDDCVQT
DEEHRNRGKLSDLVAEHLDHLHYLNDILIINCEFLNDVLTDHLLNRLFLPLYVYSLENQD
KGGERPKISLPVSLYLLSQVFLIIHHAPLVNSLAEVILNGDLSEMYAKTEQDIQRSSAKP
SIRCFIKPTETLERSLEMNKHKGKRRVQKRPNYKNVGEEEDEEKGPTEDAQEDAEKAKGT
EGGSKGIKTSGESEEIEMVIMERSKLSELAASTSVQEQNTTDEEKSAAATCSESTQWSRP
FLDMVYHALDSPDDDYHALFVLCLLYAMSHNKGMDPEKLERIQLPVPNAAEKTTYNHPLA
ERLIRIMNNAAQPDGKIRLATLELSCLLLKQQVLMSAGCIMKDVHLACLEGAREESVHLV
RHFYKGEDIFLDMFEDEYRSMTMKPMNVEYLMMDASILLPPTGTPLTGIDFVKRLPCGDV
EKTRRAIRVFFMLRSLSLQLRGEPETQLPLTREEDLIKTDDVLDLNNSDLIACTVITKDG
GMVQRFLAVDIYQMSLVEPDVSRLGWGVVKFAGLLQDMQVTGVEDDSRALNITIHKPASS
PHSKPFPILQATFIFSDHIRCIIAKQRLAKGRIQARRMKMQRIAALLDLPIQPTTEVLGF
GLGSSTSTQHLPFRFYDQGRRGSSDPTVQRSVFASVDKVPGFAVAQCINQHSSPSLSSQS
PPSASGSPSGSGSTSHCDSGGTSSSSTPSTAQSPADAPMSPELPKPHLPDQLVIVNETEA
DSKPSKNVARSAAVETASLSPSLVPARQPTISLLCEDTADTLSVESLTLVPPVDPHSLRS
LTGMPPLSTPAAACTEPVGEEAACAEPVGTAED

Sequence length

1053

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (51)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY CIRRHOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY LIVER CIRRHOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC RHINOSINUSITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMMON VARIABLE IMMUNODEFICIENCY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 1	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIC ESOPHAGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HODGKINS LYMPHOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA DEFICIENCY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, BILIARY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meniere disease	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
MICROSCOPIC COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASAL CAVITY POLYP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASAL DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROTIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-MELANOMA SKIN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CHOLANGITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CIRRHOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHINITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL ALLERGIC RHINITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SELECTIVE IGA DEFICIENCY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (92)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acquired Hypogammaglobulinemia	Common Variable Immunodeficiency	BEFREE	25891430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	25447402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Addison Disease	Addison`s Disease	BEFREE	18593762, 19500759, 20220768, 20849399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Addison Disease	Addison`s Disease	CTD_human_DG	18593762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	GWASDB_DG	22036096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	GWASCAT_DG	25608926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASDB_DG	21460841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis Juvenile	Juvenile arthritis	Pubtator	19734133, 34101054	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	19734133	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	24388013		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	GWASCAT_DG	24388013, 27182965, 27611488, 29273806, 29785011, 30552067, 30929738, 31619474		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	24388013	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	19317741, 19500759, 19734133, 19834503, 20694011, 20849399, 21179112, 22069271, 22257840, 22534877, 23151489, 25823473, 28223137, 30226884, 31435002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	19734133, 21989056, 25823473, 34643957	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	25576669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	GWASCAT_DG	21399635		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Biliary cirrhosis	Biliary cirrhosis	CTD_human_DG	21399635		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Biliary Cirrhosis, Primary, 1	Biliary cirrhosis	CTD_human_DG	21399635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	23133532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brittle diabetes	Brittle diabetes mellitus	CTD_human_DG	17632545, 18946483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	19317741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	20190752	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	GWASCAT_DG	30929738, 31036433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	GWASCAT_DG	26974007, 27992413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	20372818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	19337309	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	25891430		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	19337309, 20220768	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	20220768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	26974007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	GWASCAT_DG	26482879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	24949970, 29180353, 30970177, 31570815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	19337309, 21873553, 31570815	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	19787205, 24949970, 29180353, 30970177, 31570815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	18647951, 19337309, 19734133, 20220768, 21270831, 21873553, 21989056, 24237155, 25008175, 26782299, 30628751, 30970177, 31570815, 36622793	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	17554260, 17554300, 17632545, 18978792, 19430480, 21829393, 25751624		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	17554260, 17554300, 17632545, 18978792, 19430480, 21980299		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	17632545, 18940880, 18946483, 19178520, 19221398, 19337309, 19956107, 20220768, 21179112, 21873553, 21989056, 22069271, 22932816, 23052709, 23539116 View all (6 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	17632545, 18946483		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Ketosis-Prone	Diabetes Mellitus	CTD_human_DG	17632545, 18946483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Sudden-Onset	Diabetes Mellitus	CTD_human_DG	17632545, 18946483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	CTD_human_DG	17632545, 18946483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	21873553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	GWASCAT_DG	29904099		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves disease	Pubtator	24646814	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	24646814	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	39237981	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	GWASCAT_DG	29196614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	19787205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	26160806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunoglobulin A deficiency (disorder)	Immunoglobulin A deficiency	CTD_human_DG	20694011, 27723758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunoglobulin A deficiency (disorder)	Immunoglobulin A deficiency	GWASCAT_DG	27723758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	25891430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	19337309	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	20043139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	19734133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Libman-Sacks Disease	Nonbacterial verrucal endocardiosis	CTD_human_DG	19838195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	22257840	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	19838195, 26121298, 39796169	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	CTD_human_DG	19838195		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	23273568, 26502338, 27399966, 28714469		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASDB_DG	23273568		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	26121298		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	20043139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	18946483, 19221398, 19337309, 19375175, 19525955, 19834503, 20211854, 20220768, 20368992, 20450971, 20849399, 20952449, 21179112, 21653641, 21989056 View all (8 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	LHGDN	18946483, 18987646		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	CTD_human_DG	18946483, 19525955		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	18987646, 19337309, 19865102, 20220768, 20368992, 21653641, 21989056, 25823473, 26203907, 31228212, 34246256, 34643957, 36282535	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	GWASCAT_DG	19525953, 21833088, 24076602, 27386562, 28445677		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	19525953, 21833088		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis, Acute Fulminating	Multiple Sclerosis	CTD_human_DG	18946483, 19525955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	23133532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	19787205, 20036365, 20372818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	GWASDB_DG	21211798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	26987296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nodular Sclerosis Classical Hodgkin Lymphoma	Classical Hodgkin lymphoma	GWASCAT_DG	29196614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	GWASCAT_DG	21399635, 22961000, 26394269		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary biliary cirrhosis	Biliary Cirrhosis	CTD_human_DG	21399635		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary biliary cirrhosis	Biliary Cirrhosis	GWASDB_DG	21399635, 22961000		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	22257840		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	GWASCAT_DG	26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Respiratory Tract Diseases	Respiratory Tract Diseases	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	19221398, 19734133, 20220768		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis Allergic Seasonal	Seasonal allergic rhinitis	Pubtator	24388013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary Biliary Cholangitis	Biliary Cholangitis	CTD_human_DG	21399635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Selective immunoglobulin A deficiency	Selective Immunoglobulin A Deficiency	BEFREE	27723758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Selective immunoglobulin A deficiency	Selective Immunoglobulin A Deficiency	GWASCAT_DG	27723758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	24646814	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	25576669		★★★★★ ★☆☆☆☆ Found in Text Mining only

CLEC16A (C-type lectin domain containing 16A)