Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	23263
Gene name	MCF.2 cell line derived transforming sequence like
Gene symbol	MCF2L
Synonyms (NCBI Gene)	ARHGEF14DBSOST
Chromosome	13
Chromosome location	13q34
Summary	This gene encodes a guanine nucleotide exchange factor that interacts specifically with the GTP-bound Rac1 and plays a role in the Rho/Rac signaling pathways. A variant in this gene was associated with osteoarthritis. Alternative splicing results in multi

225

Show/Hide all (225)

miRTarBase ID	miRNA	Experiments	Reference
MIRT736677	hsa-miR-140-3p	Luciferase reporter assayWestern blottingqRT-PCR	31732956
MIRT1136833	hsa-miR-128	CLIP-seq
MIRT1136834	hsa-miR-148a	CLIP-seq
MIRT1136835	hsa-miR-148b	CLIP-seq
MIRT1136836	hsa-miR-152	CLIP-seq
MIRT1136837	hsa-miR-19a	CLIP-seq
MIRT1136838	hsa-miR-19b	CLIP-seq
MIRT1136839	hsa-miR-4697-3p	CLIP-seq
MIRT1136840	hsa-miR-4701-5p	CLIP-seq
MIRT1136841	hsa-miR-588	CLIP-seq
MIRT1136842	hsa-miR-640	CLIP-seq
MIRT1136843	hsa-miR-134	CLIP-seq
MIRT1136844	hsa-miR-145	CLIP-seq
MIRT1136845	hsa-miR-1913	CLIP-seq
MIRT1136846	hsa-miR-198	CLIP-seq
MIRT1136847	hsa-miR-2278	CLIP-seq
MIRT1136848	hsa-miR-3118	CLIP-seq
MIRT1136849	hsa-miR-3160-3p	CLIP-seq
MIRT1136850	hsa-miR-3164	CLIP-seq
MIRT1136851	hsa-miR-3168	CLIP-seq
MIRT1136852	hsa-miR-3180-5p	CLIP-seq
MIRT1136853	hsa-miR-3200-5p	CLIP-seq
MIRT1136854	hsa-miR-324-3p	CLIP-seq
MIRT1136855	hsa-miR-4277	CLIP-seq
MIRT1136856	hsa-miR-4303	CLIP-seq
MIRT1136857	hsa-miR-4468	CLIP-seq
MIRT1136858	hsa-miR-4487	CLIP-seq
MIRT1136859	hsa-miR-4494	CLIP-seq
MIRT1136840	hsa-miR-4701-5p	CLIP-seq
MIRT1136860	hsa-miR-4771	CLIP-seq
MIRT1136861	hsa-miR-4777-5p	CLIP-seq
MIRT1136862	hsa-miR-518d-5p	CLIP-seq
MIRT1136863	hsa-miR-519b-5p	CLIP-seq
MIRT1136864	hsa-miR-519c-5p	CLIP-seq
MIRT1136865	hsa-miR-520c-5p	CLIP-seq
MIRT1136866	hsa-miR-526a	CLIP-seq
MIRT1136867	hsa-miR-558	CLIP-seq
MIRT1136841	hsa-miR-588	CLIP-seq
MIRT1136842	hsa-miR-640	CLIP-seq
MIRT2038910	hsa-miR-3941	CLIP-seq
MIRT2038911	hsa-miR-4462	CLIP-seq
MIRT2038912	hsa-miR-4762-3p	CLIP-seq
MIRT2268884	hsa-miR-30a	CLIP-seq
MIRT2268885	hsa-miR-30b	CLIP-seq
MIRT2268886	hsa-miR-30c	CLIP-seq
MIRT2268887	hsa-miR-30d	CLIP-seq
MIRT2268888	hsa-miR-30e	CLIP-seq
MIRT2268889	hsa-miR-3609	CLIP-seq
MIRT2268890	hsa-miR-4495	CLIP-seq
MIRT2268891	hsa-miR-548ah	CLIP-seq
MIRT2268892	hsa-miR-101	CLIP-seq
MIRT2268893	hsa-miR-106a	CLIP-seq
MIRT2268894	hsa-miR-106b	CLIP-seq
MIRT2268895	hsa-miR-1236	CLIP-seq
MIRT2268896	hsa-miR-1255a	CLIP-seq
MIRT2268897	hsa-miR-1255b	CLIP-seq
MIRT2268898	hsa-miR-127-5p	CLIP-seq
MIRT1136833	hsa-miR-128	CLIP-seq
MIRT2268899	hsa-miR-1285	CLIP-seq
MIRT2268900	hsa-miR-1304	CLIP-seq
MIRT2268901	hsa-miR-1343	CLIP-seq
MIRT2268902	hsa-miR-144	CLIP-seq
MIRT2268903	hsa-miR-1468	CLIP-seq
MIRT2268904	hsa-miR-1587	CLIP-seq
MIRT2268905	hsa-miR-15a	CLIP-seq
MIRT2268906	hsa-miR-15b	CLIP-seq
MIRT2268907	hsa-miR-16	CLIP-seq
MIRT2268908	hsa-miR-17	CLIP-seq
MIRT2268909	hsa-miR-195	CLIP-seq
MIRT2268910	hsa-miR-20a	CLIP-seq
MIRT2268911	hsa-miR-20b	CLIP-seq
MIRT2268912	hsa-miR-2115	CLIP-seq
MIRT2268913	hsa-miR-214	CLIP-seq
MIRT2268914	hsa-miR-217	CLIP-seq
MIRT2268915	hsa-miR-22	CLIP-seq
MIRT2268916	hsa-miR-2964a-5p	CLIP-seq
MIRT2268917	hsa-miR-298	CLIP-seq
MIRT2268884	hsa-miR-30a	CLIP-seq
MIRT2268885	hsa-miR-30b	CLIP-seq
MIRT2268886	hsa-miR-30c	CLIP-seq
MIRT2268887	hsa-miR-30d	CLIP-seq
MIRT2268888	hsa-miR-30e	CLIP-seq
MIRT2268918	hsa-miR-3115	CLIP-seq
MIRT2268919	hsa-miR-3125	CLIP-seq
MIRT2268920	hsa-miR-3127-5p	CLIP-seq
MIRT2268921	hsa-miR-3133	CLIP-seq
MIRT2268922	hsa-miR-3140-3p	CLIP-seq
MIRT2268923	hsa-miR-3145-3p	CLIP-seq
MIRT2268924	hsa-miR-3150a-3p	CLIP-seq
MIRT2268925	hsa-miR-3158-5p	CLIP-seq
MIRT2268926	hsa-miR-3165	CLIP-seq
MIRT2268927	hsa-miR-3175	CLIP-seq
MIRT2268928	hsa-miR-3176	CLIP-seq
MIRT2268929	hsa-miR-3184	CLIP-seq
MIRT2268930	hsa-miR-3185	CLIP-seq
MIRT2268931	hsa-miR-3187-5p	CLIP-seq
MIRT2268932	hsa-miR-3192	CLIP-seq
MIRT2268933	hsa-miR-320a	CLIP-seq
MIRT2268934	hsa-miR-320b	CLIP-seq
MIRT2268935	hsa-miR-320c	CLIP-seq
MIRT2268936	hsa-miR-320d	CLIP-seq
MIRT2268937	hsa-miR-323-5p	CLIP-seq
MIRT2268938	hsa-miR-329	CLIP-seq
MIRT2268939	hsa-miR-337-3p	CLIP-seq
MIRT2268940	hsa-miR-3607-3p	CLIP-seq
MIRT2268889	hsa-miR-3609	CLIP-seq
MIRT2268941	hsa-miR-3613-3p	CLIP-seq
MIRT2268942	hsa-miR-3619-5p	CLIP-seq
MIRT2268943	hsa-miR-3620	CLIP-seq
MIRT2268944	hsa-miR-3622a-3p	CLIP-seq
MIRT2268945	hsa-miR-3622b-3p	CLIP-seq
MIRT2268946	hsa-miR-362-3p	CLIP-seq
MIRT2268947	hsa-miR-3671	CLIP-seq
MIRT2268948	hsa-miR-3675-5p	CLIP-seq
MIRT2268949	hsa-miR-3681	CLIP-seq
MIRT2268950	hsa-miR-3686	CLIP-seq
MIRT2268951	hsa-miR-3689a-3p	CLIP-seq
MIRT2268952	hsa-miR-3689c	CLIP-seq
MIRT2268953	hsa-miR-3689d	CLIP-seq
MIRT2268954	hsa-miR-3691-5p	CLIP-seq
MIRT2268955	hsa-miR-378g	CLIP-seq
MIRT2268956	hsa-miR-3916	CLIP-seq
MIRT2268957	hsa-miR-3922-3p	CLIP-seq
MIRT2268958	hsa-miR-3926	CLIP-seq
MIRT2038910	hsa-miR-3941	CLIP-seq
MIRT2268959	hsa-miR-3973	CLIP-seq
MIRT2268960	hsa-miR-423-5p	CLIP-seq
MIRT2268961	hsa-miR-424	CLIP-seq
MIRT2268962	hsa-miR-4254	CLIP-seq
MIRT2268963	hsa-miR-4257	CLIP-seq
MIRT2268964	hsa-miR-4270	CLIP-seq
MIRT2268965	hsa-miR-4272	CLIP-seq
MIRT2268966	hsa-miR-4282	CLIP-seq
MIRT2268967	hsa-miR-4291	CLIP-seq
MIRT2268968	hsa-miR-4299	CLIP-seq
MIRT2268969	hsa-miR-4300	CLIP-seq
MIRT2268970	hsa-miR-4308	CLIP-seq
MIRT2268971	hsa-miR-4429	CLIP-seq
MIRT2268972	hsa-miR-4435	CLIP-seq
MIRT2268973	hsa-miR-4441	CLIP-seq
MIRT2268974	hsa-miR-4486	CLIP-seq
MIRT2268975	hsa-miR-4492	CLIP-seq
MIRT2268890	hsa-miR-4495	CLIP-seq
MIRT2268976	hsa-miR-4498	CLIP-seq
MIRT2268977	hsa-miR-4511	CLIP-seq
MIRT2268978	hsa-miR-4643	CLIP-seq
MIRT2268979	hsa-miR-4645-3p	CLIP-seq
MIRT2268980	hsa-miR-4656	CLIP-seq
MIRT2268981	hsa-miR-466	CLIP-seq
MIRT2268982	hsa-miR-4666-5p	CLIP-seq
MIRT2268983	hsa-miR-4672	CLIP-seq
MIRT2268984	hsa-miR-4675	CLIP-seq
MIRT2268985	hsa-miR-4680-5p	CLIP-seq
MIRT2268986	hsa-miR-4691-3p	CLIP-seq
MIRT1136840	hsa-miR-4701-5p	CLIP-seq
MIRT2268987	hsa-miR-4717-3p	CLIP-seq
MIRT2268988	hsa-miR-4728-5p	CLIP-seq
MIRT2268989	hsa-miR-4738-3p	CLIP-seq
MIRT2268990	hsa-miR-4741	CLIP-seq
MIRT2268991	hsa-miR-4763-5p	CLIP-seq
MIRT2268992	hsa-miR-4789-3p	CLIP-seq
MIRT2268993	hsa-miR-4796-3p	CLIP-seq
MIRT2268994	hsa-miR-494	CLIP-seq
MIRT2268995	hsa-miR-497	CLIP-seq
MIRT2268996	hsa-miR-499-3p	CLIP-seq
MIRT2268997	hsa-miR-499a-3p	CLIP-seq
MIRT2268998	hsa-miR-515-3p	CLIP-seq
MIRT2268999	hsa-miR-516a-3p	CLIP-seq
MIRT2269000	hsa-miR-519d	CLIP-seq
MIRT2269001	hsa-miR-519e	CLIP-seq
MIRT2269002	hsa-miR-542-3p	CLIP-seq
MIRT2268891	hsa-miR-548ah	CLIP-seq
MIRT2269003	hsa-miR-548k	CLIP-seq
MIRT2269004	hsa-miR-548t	CLIP-seq
MIRT2269005	hsa-miR-587	CLIP-seq
MIRT1136841	hsa-miR-588	CLIP-seq
MIRT2269006	hsa-miR-593	CLIP-seq
MIRT2269007	hsa-miR-598	CLIP-seq
MIRT2269008	hsa-miR-603	CLIP-seq
MIRT2269009	hsa-miR-612	CLIP-seq
MIRT2269010	hsa-miR-616	CLIP-seq
MIRT2269011	hsa-miR-626	CLIP-seq
MIRT2269012	hsa-miR-642b	CLIP-seq
MIRT2269013	hsa-miR-761	CLIP-seq
MIRT2269014	hsa-miR-762	CLIP-seq
MIRT2269015	hsa-miR-876-3p	CLIP-seq
MIRT2269016	hsa-miR-920	CLIP-seq
MIRT2269017	hsa-miR-922	CLIP-seq
MIRT2269018	hsa-miR-93	CLIP-seq
MIRT2269019	hsa-miR-939	CLIP-seq
MIRT2390699	hsa-miR-1207-5p	CLIP-seq
MIRT2390700	hsa-miR-3714	CLIP-seq
MIRT2268965	hsa-miR-4272	CLIP-seq
MIRT2390701	hsa-miR-4532	CLIP-seq
MIRT2390702	hsa-miR-4632	CLIP-seq
MIRT2390703	hsa-miR-4666-3p	CLIP-seq
MIRT2390704	hsa-miR-4736	CLIP-seq
MIRT2390705	hsa-miR-4763-3p	CLIP-seq
MIRT2268991	hsa-miR-4763-5p	CLIP-seq
MIRT2390706	hsa-miR-548an	CLIP-seq
MIRT2390707	hsa-miR-566	CLIP-seq
MIRT2269007	hsa-miR-598	CLIP-seq
MIRT2453823	hsa-miR-1287	CLIP-seq
MIRT2453824	hsa-miR-3135b	CLIP-seq
MIRT2453825	hsa-miR-3148	CLIP-seq
MIRT2453826	hsa-miR-3912	CLIP-seq
MIRT2453827	hsa-miR-875-3p	CLIP-seq
MIRT2268915	hsa-miR-22	CLIP-seq
MIRT2268919	hsa-miR-3125	CLIP-seq
MIRT2268933	hsa-miR-320a	CLIP-seq
MIRT2268934	hsa-miR-320b	CLIP-seq
MIRT2268935	hsa-miR-320c	CLIP-seq
MIRT2268936	hsa-miR-320d	CLIP-seq
MIRT2268956	hsa-miR-3916	CLIP-seq
MIRT2268963	hsa-miR-4257	CLIP-seq
MIRT2268971	hsa-miR-4429	CLIP-seq
MIRT2268915	hsa-miR-22	CLIP-seq
MIRT2268919	hsa-miR-3125	CLIP-seq
MIRT2268933	hsa-miR-320a	CLIP-seq
MIRT2268934	hsa-miR-320b	CLIP-seq
MIRT2268935	hsa-miR-320c	CLIP-seq
MIRT2268936	hsa-miR-320d	CLIP-seq
MIRT2268956	hsa-miR-3916	CLIP-seq
MIRT2268963	hsa-miR-4257	CLIP-seq
MIRT2268971	hsa-miR-4429	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IBA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IDA	15157669
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IEA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	TAS
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005615	Component	Extracellular space	HDA	22664934
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	15157669
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0012505	Component	Endomembrane system	IDA	15157669
GO:0012505	Component	Endomembrane system	IEA
GO:0016020	Component	Membrane	IEA
GO:0031234	Component	Extrinsic component of cytoplasmic side of plasma membrane	IDA	15157669
GO:0035025	Process	Positive regulation of Rho protein signal transduction	IDA	15157669
GO:0035091	Function	Phosphatidylinositol binding	IDA	15157669
GO:0035091	Function	Phosphatidylinositol binding	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	IEA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	TAS

MIM	HGNC	e!Ensembl
609499	14576	ENSG00000126217

O15068

Protein name

Guanine nucleotide exchange factor DBS (DBL's big sister) (MCF2-transforming sequence-like protein)

Protein function

Guanine nucleotide exchange factor that catalyzes guanine nucleotide exchange on RHOA and CDC42, and thereby contributes to the regulation of RHOA and CDC42 signaling pathways (By similarity). Seems to lack activity with RAC1. Becomes activated

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13716	CRAL_TRIO_2	91 → 225	Divergent CRAL/TRIO domain	Domain
PF00435	Spectrin	351 → 456	Spectrin repeat	Domain
PF00621	RhoGEF	635 → 809	RhoGEF domain	Domain
PF00169	PH	830 → 945	PH domain	Domain
PF07653	SH3_2	1059 → 1114	Variant SH3 domain	Domain

Sequence

MFDCWRFILCKRPGSNSYSSPQRPNEAKKEETDHQIDVSDVIRLVQDTPEATAMATDEIM
HQDIVPLCAADIQDQLKKRFAYLSGGRGQDGSPVITFPDYPAFSEIPDKEFQNVMTYLTS
IPSLQDAGIGFILVIDRRRDKWTSVKASVLRIAASFPANLQLVLVLRPTGFFQRTLSDIA
FKFNRDDFKMKVPVIMLSSVPDLHGYIDKSQLTEDLGGTLDYCHSRWLCQRTAIESFALM
VKQTAQMLQSFGTELAETELPNDVQSTSSVLCAHTEKKDKAKEDLRLALKEGHSVLESLR
ELQAEGSEPSVNQDQLDNQATVQRLLAQLNETEAAFDEFWAKHQQKLEQCLQLRHFEQGF
REVKAILDAASQKIATFTDIGNSLAHVEHLLRDLASFEEKSGVAVERARALSLDGEQLIG
NKHYAVDSIRPKCQELRHLCDQFSAEIARRRGLLSKSLELHRRLETSMKWCDEGIYLLAS
QPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNAIYKEYESILNQDLMEHVRKVFQKQ
ASMEEVFHRRQASLKKLAARQTRPVQPVAPRPEALAKSPCPSPGIRRGSENSSSEGGALR
RGPYRRAKSEMSESRQGRGSAGEEEESLAILRRHVMSELLDTERAYVEELLCVLEGYAAE
MDNPLMAHLLSTGLHNKKDVLFGNMEEIYHFHNRIFLRELENYTDCPELVGRCFLERMED
FQIYEKYCQNKPRSESLWRQCSDCPFFQECQRKLDHKLSLDSYLLKPVQRITKYQLLLKE
MLKYSRNCEGAEDLQEALSSILGILKAVNDSMHLIAITGYDGNLGDLGKLLMQGSFSVWT
DHKRGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGYEKAPSYSYKQSLNMAAVG
ITENVKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRAL
EQSQSLPLPAPTSTSPSRGNSRNIKKLEERKTDPLSLEGYVSSAPLTKPPEKGKGWSKTS
HSLEAPEDDGGWSSAEEQINSSDAEEDGGLGPKKLVPGKYTVVADHEKGGPDALRVRSGD
VVELVQEGDEGLWYVRDPTTGKEGWVPASSLSVRLGPSGSAQCLSSSGKAHVPRAHP

Sequence length

1137

Interactions

View interactions

	Reactome
			NRAGE signals death through JNK Rho GTPase cycle G alpha (12/13) signalling events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
APPENDICITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (82)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	30045751, 33069246	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	BEFREE	28320164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	25898923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	25898923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	25898923	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	31089935		★★★★★ ★☆☆☆☆ Found in Text Mining only
bilateral breast cancer	Breast Cancer	BEFREE	25409685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar II disorder	Bipolar Disorder	BEFREE	31581800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blepharospasm	Blepharospasm	BEFREE	31078682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19366686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19366686, 25483302, 37110517	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Camptocormia	Camptocormia	BEFREE	28157107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Capillary malformation (disorder)	Capillary malformation	BEFREE	29285760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	25898923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	25898923	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	27289260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choreoathetosis	Choreoathetosis	BEFREE	30718219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	18768505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Degenerative polyarthritis	Arthritis	BEFREE	21871595, 22178404, 26584642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	GWASCAT_DG	21871595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	GWASDB_DG	21871595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	30267364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	28582689, 28676842, 28991666, 29129763		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	29538685, 29845013, 30414974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29794060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29794060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disruptive, Impulse Control, and Conduct Disorders	Impulse control disorder	BEFREE	28827010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disturbance in mood	Mood Disorder	BEFREE	29538685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Donnai-Barrow syndrome	Donnai-Barrow Syndrome	BEFREE	18553518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	31234775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysarthria	Dysarthria	BEFREE	31571270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	12869808, 27061943, 28913772, 29433807, 29444973, 29538685, 31494731, 31571277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystonia Disorders	Dystonia	BEFREE	15852393, 19890997, 20083014, 24178706, 26725140, 27289260, 27707656, 27743838, 27862284, 28195407, 28690015, 28964627, 28972096, 29246604, 29576500 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystonia, Primary	Dystonia	BEFREE	29137852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	29129763, 29306976, 30268433, 30500485, 31794952, 31834012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Tremor	Tremor	BEFREE	28124434, 28163141, 28370272, 28597557, 29196249, 29391468, 29797064, 29975951, 30045955, 30827864, 30875687, 31680866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	BEFREE	23756194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Dystonia	Dystonia	BEFREE	19890997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	29295486, 30042071, 30611137, 31114210, 31370042, 31647199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glut1 Deficiency Syndrome	GLUT1 Deficiency Syndrome	BEFREE	29899725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hallervorden-Spatz Syndrome	Pigmentary pallidal degeneration	BEFREE	15852393, 28055131, 31463603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemiballismus	Hemiballismus	BEFREE	31541757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	29725840, 30325816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothalamic hamartomas	Hypothalamic Hamartomas	BEFREE	30970205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	BEFREE	28103688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	19193835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29538685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	23756194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	31581800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19366686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31028291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23555185, 31089935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29538685, 29845013, 30414974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	27981031, 30621216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	28582689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood swings	Mood swings	BEFREE	29887826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement Disorders	BEFREE	28320164, 29725840, 30268433, 30633810, 31077436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	39748436	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myoclonic dystonia	Myoclonic Dystonia	BEFREE	30302819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21325287		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	29266596, 29797064, 30894331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nevus comedonicus	Nevus comedonicus	BEFREE	26831335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	27301979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	29860948, 30670359, 31313803, 31383848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	25483302, 26584642	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis Knee	Osteoarthritis	Pubtator	22615457	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	27210803, 28198975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	10697522, 15138570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	20177695, 22713408, 27771287, 27982769, 28262813, 28320164, 28434004, 28597557, 28638714, 28669542, 28676842, 28761773, 28827010, 29031219, 29032347 View all (32 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	27818350, 28590521, 28913772, 29164724, 29249683, 29532240, 30357911, 30616868, 31466414, 31755599, 31758821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	23938256, 30153389, 30853908, 31078682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	28582689, 28676842, 28991666, 29129763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31028291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23555185	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	18768505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Restless Legs Syndrome	BEFREE	29887129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	21482453, 29242310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	BEFREE	28712731, 30082148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	30616868, 30975618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	31581800		★★★★★ ★☆☆☆☆ Found in Text Mining only

MCF2L (MCF.2 cell line derived transforming sequence like)