PHLPP1 (PH domain and leucine rich repeat protein phosphatase 1)

Gene

• Entrez ID: 23239
• Gene name: PH domain and leucine rich repeat protein phosphatase 1
• Gene symbol: PHLPP1
• Synonyms (NCBI Gene): PHLPP, PLEKHE1, PPM3A, SCOP
• Chromosome: 18
• Chromosome location: 18q21.33
• Summary: This gene encodes a member of the serine/threonine phosphatase family. The encoded protein promotes apoptosis by dephosphorylating and inactivating the serine/threonine kinase Akt, and functions as a tumor suppressor in multiple types of cancer. Increased

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019235	hsa-miR-331-3p	Sequencing	20371350
MIRT021082	hsa-miR-190a-5p	Reporter assay;Western blot	21750348
MIRT041846	hsa-miR-484	CLASH	23622248
MIRT037351	hsa-miR-877-5p	CLASH	23622248
MIRT035820	hsa-miR-1307-3p	CLASH	23622248
MIRT052967	hsa-miR-17-5p	Immunoblot, Luciferase reporter assay	22116552
MIRT052968	hsa-miR-18a-5p	Immunoblot, Luciferase reporter assay	22116552
MIRT052969	hsa-miR-19a-3p	Immunoblot, Luciferase reporter assay	22116552
MIRT052970	hsa-miR-92a-3p	Immunoblot, Luciferase reporter assay	22116552
MIRT019235	hsa-miR-331-3p	Luciferase reporter assay	24825302
MIRT053250	hsa-miR-224-5p	Immunoprecipitaion, Luciferase reporter assay, Western blot	23846336
MIRT053250	hsa-miR-224-5p	Immunoprecipitaion, Luciferase reporter assay, Western blot	23846336
MIRT053250	hsa-miR-224-5p	Immunoprecipitaion, Luciferase reporter assay, Western blot	23846336
MIRT053250	hsa-miR-224-5p	Immunoprecipitaion, Luciferase reporter assay, Western blot	23846336
MIRT054811	hsa-miR-141-3p	Luciferase reporter assay, qRT-PCR	24945731
MIRT438165	hsa-miR-200b-3p	Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	24337069
MIRT438165	hsa-miR-200b-3p	Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	24337069
MIRT438164	hsa-miR-375	Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	24337069
MIRT438164	hsa-miR-375	Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	24337069
MIRT438163	hsa-miR-15a-5p	Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	24337069
MIRT438163	hsa-miR-15a-5p	Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	24337069
MIRT021082	hsa-miR-190a-5p	qRT-PCR, Luciferase reporter assay, Western blot	23396362
MIRT438165	hsa-miR-200b-3p	Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	24337069
MIRT438165	hsa-miR-200b-3p	Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	24337069
MIRT438164	hsa-miR-375	Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	24337069
MIRT438164	hsa-miR-375	Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	24337069
MIRT438163	hsa-miR-15a-5p	Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	24337069
MIRT438163	hsa-miR-15a-5p	Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	24337069
MIRT021082	hsa-miR-190a-5p	qRT-PCR, Luciferase reporter assay, Western blot	23396362
MIRT644106	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT644105	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT535293	hsa-miR-6835-3p	PAR-CLIP	22012620
MIRT535292	hsa-miR-4422	PAR-CLIP	22012620
MIRT535291	hsa-miR-495-3p	PAR-CLIP	22012620
MIRT535290	hsa-miR-5688	PAR-CLIP	22012620
MIRT535289	hsa-miR-7-1-3p	PAR-CLIP	22012620
MIRT535288	hsa-miR-7-2-3p	PAR-CLIP	22012620
MIRT199173	hsa-miR-4495	PAR-CLIP	22012620
MIRT199172	hsa-miR-1279	PAR-CLIP	22012620
MIRT535287	hsa-miR-7112-3p	PAR-CLIP	22012620
MIRT053250	hsa-miR-224-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	26245343
MIRT053250	hsa-miR-224-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	26245343
MIRT644106	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT644105	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT535293	hsa-miR-6835-3p	PAR-CLIP	22012620
MIRT535292	hsa-miR-4422	PAR-CLIP	22012620
MIRT535291	hsa-miR-495-3p	PAR-CLIP	22012620
MIRT535290	hsa-miR-5688	PAR-CLIP	22012620
MIRT535289	hsa-miR-7-1-3p	PAR-CLIP	22012620
MIRT535288	hsa-miR-7-2-3p	PAR-CLIP	22012620
MIRT199173	hsa-miR-4495	PAR-CLIP	22012620
MIRT199172	hsa-miR-1279	PAR-CLIP	22012620
MIRT535287	hsa-miR-7112-3p	PAR-CLIP	22012620
MIRT1232119	hsa-miR-299-5p	CLIP-seq
MIRT1232120	hsa-miR-548aa	CLIP-seq
MIRT1232121	hsa-miR-548n	CLIP-seq
MIRT1232122	hsa-miR-548t	CLIP-seq
MIRT1552301	hsa-miR-1273e	CLIP-seq
MIRT1552302	hsa-miR-2113	CLIP-seq
MIRT1552303	hsa-miR-496	CLIP-seq
MIRT2068132	hsa-miR-1184	CLIP-seq
MIRT2068133	hsa-miR-1265	CLIP-seq
MIRT2068134	hsa-miR-1283	CLIP-seq
MIRT2068135	hsa-miR-1301	CLIP-seq
MIRT2068136	hsa-miR-141	CLIP-seq
MIRT2068137	hsa-miR-200a	CLIP-seq
MIRT1552302	hsa-miR-2113	CLIP-seq
MIRT2068138	hsa-miR-4418	CLIP-seq
MIRT2068139	hsa-miR-4491	CLIP-seq
MIRT2068140	hsa-miR-4657	CLIP-seq
MIRT2068141	hsa-miR-4660	CLIP-seq
MIRT2068142	hsa-miR-4723-5p	CLIP-seq
MIRT2068143	hsa-miR-4764-5p	CLIP-seq
MIRT2068144	hsa-miR-4768-5p	CLIP-seq
MIRT2068145	hsa-miR-5047	CLIP-seq
MIRT2068146	hsa-miR-509-3-5p	CLIP-seq
MIRT2068147	hsa-miR-509-5p	CLIP-seq
MIRT2068148	hsa-miR-610	CLIP-seq
MIRT2068132	hsa-miR-1184	CLIP-seq
MIRT1552301	hsa-miR-1273e	CLIP-seq
MIRT2068134	hsa-miR-1283	CLIP-seq
MIRT2295473	hsa-miR-1284	CLIP-seq
MIRT2068135	hsa-miR-1301	CLIP-seq
MIRT2068136	hsa-miR-141	CLIP-seq
MIRT2068137	hsa-miR-200a	CLIP-seq
MIRT1552302	hsa-miR-2113	CLIP-seq
MIRT2295474	hsa-miR-219-5p	CLIP-seq
MIRT2295475	hsa-miR-300	CLIP-seq
MIRT2295476	hsa-miR-3156-5p	CLIP-seq
MIRT2295477	hsa-miR-323-3p	CLIP-seq
MIRT2295478	hsa-miR-326	CLIP-seq
MIRT2295479	hsa-miR-330-5p	CLIP-seq
MIRT2295480	hsa-miR-3616-5p	CLIP-seq
MIRT2295481	hsa-miR-3647-5p	CLIP-seq
MIRT2295482	hsa-miR-3688-3p	CLIP-seq
MIRT2295483	hsa-miR-380	CLIP-seq
MIRT2295484	hsa-miR-381	CLIP-seq
MIRT2295485	hsa-miR-4273	CLIP-seq
MIRT2295486	hsa-miR-4276	CLIP-seq
MIRT2295487	hsa-miR-4445	CLIP-seq
MIRT2295488	hsa-miR-452	CLIP-seq
MIRT2068141	hsa-miR-4660	CLIP-seq
MIRT2295489	hsa-miR-4666-3p	CLIP-seq
MIRT2295490	hsa-miR-4676-3p	CLIP-seq
MIRT2295491	hsa-miR-4699-3p	CLIP-seq
MIRT2068144	hsa-miR-4768-5p	CLIP-seq
MIRT2295492	hsa-miR-4782-3p	CLIP-seq
MIRT2295493	hsa-miR-4795-5p	CLIP-seq
MIRT1552303	hsa-miR-496	CLIP-seq
MIRT2068145	hsa-miR-5047	CLIP-seq
MIRT2295494	hsa-miR-508-3p	CLIP-seq
MIRT1232121	hsa-miR-548n	CLIP-seq
MIRT1232122	hsa-miR-548t	CLIP-seq
MIRT2295495	hsa-miR-573	CLIP-seq
MIRT2068148	hsa-miR-610	CLIP-seq
MIRT2295496	hsa-miR-618	CLIP-seq
MIRT2295497	hsa-miR-767-3p	CLIP-seq
MIRT2068132	hsa-miR-1184	CLIP-seq
MIRT2593141	hsa-miR-1294	CLIP-seq
MIRT2068135	hsa-miR-1301	CLIP-seq
MIRT2068136	hsa-miR-141	CLIP-seq
MIRT2593142	hsa-miR-1827	CLIP-seq
MIRT2068137	hsa-miR-200a	CLIP-seq
MIRT1552302	hsa-miR-2113	CLIP-seq
MIRT2593143	hsa-miR-219-1-3p	CLIP-seq
MIRT2593144	hsa-miR-3155	CLIP-seq
MIRT2593145	hsa-miR-3155b	CLIP-seq
MIRT2295480	hsa-miR-3616-5p	CLIP-seq
MIRT2295481	hsa-miR-3647-5p	CLIP-seq
MIRT2593146	hsa-miR-425	CLIP-seq
MIRT2295486	hsa-miR-4276	CLIP-seq
MIRT2593147	hsa-miR-4316	CLIP-seq
MIRT2068138	hsa-miR-4418	CLIP-seq
MIRT2593148	hsa-miR-4514	CLIP-seq
MIRT2068141	hsa-miR-4660	CLIP-seq
MIRT2593149	hsa-miR-4692	CLIP-seq
MIRT2295493	hsa-miR-4795-5p	CLIP-seq
MIRT2068145	hsa-miR-5047	CLIP-seq
MIRT2068146	hsa-miR-509-3-5p	CLIP-seq
MIRT2068147	hsa-miR-509-5p	CLIP-seq
MIRT2593150	hsa-miR-571	CLIP-seq
MIRT2295495	hsa-miR-573	CLIP-seq
MIRT2295497	hsa-miR-767-3p	CLIP-seq
MIRT2593151	hsa-miR-940	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002667	Process	Regulation of T cell anergy	IEA
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004722	Function	Protein serine/threonine phosphatase activity	IBA
GO:0004722	Function	Protein serine/threonine phosphatase activity	IDA	28147277
GO:0004722	Function	Protein serine/threonine phosphatase activity	IEA
GO:0005515	Function	Protein binding	IPI	18162466, 19615732, 21701506, 21804599, 24145035, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IC	28147277
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0009649	Process	Entrainment of circadian clock	IEA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0042981	Process	Regulation of apoptotic process	IDA	20513427
GO:0043408	Process	Regulation of MAPK cascade	IMP	24530606
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	28147277
GO:0046328	Process	Regulation of JNK cascade	IDA	17386267
GO:0046872	Function	Metal ion binding	IEA
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	17386267
GO:1900744	Process	Regulation of p38MAPK cascade	IDA	17386267

Other IDs

• MIM: 609396
• HGNC: 20610
• e!Ensembl: ENSG00000081913

Protein

• UniProt ID: O60346
• Protein name: PH domain leucine-rich repeat-containing protein phosphatase 1 (EC 3.1.3.16) (Pleckstrin homology domain-containing family E member 1) (PH domain-containing family E member 1) (Suprachiasmatic nucleus circadian oscillatory protein) (hSCOP)
• Protein function: Protein phosphatase involved in regulation of Akt and PKC signaling. Mediates dephosphorylation in the C-terminal domain hydrophobic motif of members of the AGC Ser/Thr protein kinase family; specifically acts on 'Ser-473' of AKT2 and AKT3, 'Ser
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00169	PH	537 → 636	PH domain	Domain
  PF13516	LRR_6	691 → 705	Leucine Rich repeat	Repeat
  PF13855	LRR_8	714 → 772	Leucine rich repeat	Repeat
  PF13516	LRR_6	829 → 849	Leucine Rich repeat	Repeat
  PF00481	PP2C	1174 → 1415	Protein phosphatase 2C	Family

• Tissue specificity: TISSUE SPECIFICITY: In colorectal cancer tissue, expression is highest in the surface epithelium of normal colonic mucosa adjacent to the cancer tissue but is largely excluded from the crypt bases. Expression is lost or significantly decreased in 78% of t
• Sequence:

  MEPAAAATVQRLPELGREDRASAPAAAAAAAAAAAAAAAALAAAAGGGRSPEPALTPAAP
  SGGNGSGSGAREEAPGEAPPGPLPGRAGGAGRRRRRGAPQPIAGGAAPVPGAGGGANSLL
  LRRGRLKRNLSAAAAAASSSSSSSAAAASHSPGAAGLPASCSASASLCTRSLDRKTLLLK
  HRQTLQLQPSDRDWVRHQLQRGCVHVFDRHMASTYLRPVLCTLDTTAGEVAARLLQLGHK
  GGGVVKVLGQGPGAAAAREPAEPPPEAGPRLAPPEPRDSEVPPARSAPGAFGGPPRAPPA
  DLPLPVGGPGGWSRRASPAPSDSSPGEPFVGGPVSSPRAPRPVVSDTESFSLSPSAESVS
  DRLDPYSSGGGSSSSSEELEADAASAPTGVPGQPRRPGHPAQPLPLPQTASSPQPQQKAP
  RAIDSPGGAVREGSCEEKAAAAVAPGGLQSTPGRSGVTAEKAPPPPPPPTLYVQLHGETT
  RRLEAEEKPLQIQNDYLFQLGFGELWRVQEEGMDSEIGCLIRFYAGKPHSTGSSERIQLS
  GMYNVRKGKMQLPVNRWTRRQVILCGTCLIVSSVKDSLTGKMHVLPLIGGKVEEVKKHQH
  CLAFSSSGPQSQTYYICFDTFTEYLRWLRQVSKVASQRISSVDLSCCSLEHLPANLFYSQ
  DLTHLNLKQNFLRQNPSLPAARGLNELQRFTKLKSLNLSNNHLGDFPLAVCSIPTLAELN
  VSCNALRSVPAAVGVMHNLQTFLLDGNFLQSLPAELENMKQLSYLGLSFNEFTDIPEVLE
  KLTAVDKLCMSGNCVETLRLQALRKMPHIKHVDLRLNVIRKLIADEVDFLQHVTQLDLRD
  NKLGDLDAMIFNNIEVLHCERNQLVTLDICGYFLKALYASSNELVQLDVYPVPNYLSYMD
  VSRNRLENVPEWVCESRKLEVLDIGHNQICELPARLFCNSSLRKLLAGHNQLARLPERLE
  RTSVEVLDVQHNQLLELPPNLLMKADSLRFLNASANKLESLPPATLSEETNSILQELYLT
  NNSLTDKCVPLLTGHPHLKILHMAYNRLQSFPASKMAKLEELEEIDLSGNKLKAIPTTIM
  NCRRMHTVIAHSNCIEVFPEVMQLPEIKCVDLSCNELSEVTLPENLPPKLQELDLTGNPR
  LVLDHKTLELLNNIRCFKIDQPSTGDASGAPAVWSHGYTEASGVKNKLCVAALSVNNFCD
  NREALYGVFDGDRNVEVPYLLQCTMSDILAEELQKTKNEEEYMVNTFIVMQRKLGTAGQK
  LGGAAVLCHIKHDPVDPGGSFTLTSANVGKCQTVLCRNGKPLPLSRSYIMSCEEELKRIK
  QHKAIITEDGKVNGVTESTRILGYTFLHPSVVPRPHVQSVLLTPQDEFFILGSKGLWDSL
  SVEEAVEAVRNVPDALAAAKKLCTLAQSYGCHDSISAVVVQLSVTEDSFCCCELSAGGAV
  PPPSPGIFPPSVNMVIKDRPSDGLGVPSSSSGMASEISSELSTSEMSSEVGSTASDEPPP
  GALSENSPAYPSEQRCMLHPICLSNSFQRQLSSATFSSAFSDNGLDSDDEEPIEGVFTNG
  SRVEVEVDIHCSRAKEKEKQQHLLQVPAEASDEGIVISANEDEPGLPRKADFSAVGTIGR
  RRANGSVAPQERSHNVIEVATDAPLRKPGGYFAAPAQPDPDDQFIIPPELEEEVKEIMKH
  HQEQQQQQQPPPPPQLQPQLPRHYQLDQLPDYYDTPL

• Sequence length: 1717

Pathways

KEGG:

PI3K-Akt signaling pathway

Reactome:

Negative regulation of the PI3K/AKT network

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Attention deficit hyperactivity disorder	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Focal impaired awareness seizure	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FOCAL ONSET IMPAIRED AWARENESS EPILEPTIC SEIZURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HODGKINS LYMPHOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seizure	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	24530606		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28938613		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	30904392		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26760962		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	21454620		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	24023368		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21177869, 31178227	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21750348	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22426999		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	26760962	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	22183558	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28428363		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	26823799	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	20861921		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon Carcinoma	Colon Carcinoma	BEFREE	21177869, 26107137		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	19079341		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	24530606		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23846336, 24145035, 24530606		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15808505, 19797085, 24061475	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21177869, 24145035, 29194591, 34663797	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	24530606		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	29940243		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29068480, 29775231		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	27631101		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	27913677		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	33920886	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22183558	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	27913677		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	18204829, 23727064, 28428363		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	23727064, 29655866		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	26245343	Associate	★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	25895131, 28212545		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	15808505	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21454620, 26971226		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21804599	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21454620, 26971226		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	26971226		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	19745829		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29655866		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24061475	Inhibit	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	31582730		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21461637, 25617127, 27688096, 30092222		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	21461637		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26463718, 33029497	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25793736	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28139510, 34982011	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	20574456, 20861921		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	25895131, 28212545		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22426999		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21840483, 25216524, 27955654		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22144674, 24703948, 25895131, 27913677, 29775231, 30904392		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21177869, 24061475, 26107137		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	24121273, 29391600		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	36781840	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	29391600		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	30861201		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	29940243		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20861921, 21177869, 21454620, 21840483, 22426999, 23846336, 23856247, 24061475, 24530606, 25216524, 25793736, 25895131, 26107137, 26760962, 26971226, 30092222, 30821592		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24945731		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	21461637		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28139510	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	26760962		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	26760962	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	38184561	Associate	★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	27631101		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	21840483, 24337069, 25216524, 27955654		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	21840483, 22144674		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21840483	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22340730	Inhibit	★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	28139510	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	25793736		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	26245343		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25793736	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	25793736		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34982011	Associate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	30143532		★☆☆☆☆ Found in Text Mining only