Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	23237
Gene name	Activity regulated cytoskeleton associated protein
Gene symbol	ARC
Synonyms (NCBI Gene)	Arg3.1hArc
Chromosome	8
Chromosome location	8q24.3

191

Show/Hide all (191)

miRTarBase ID	miRNA	Experiments	Reference
MIRT043974	hsa-miR-378a-5p	CLASH	23622248
MIRT053767	hsa-miR-185-5p	ImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot	24763054
MIRT053767	hsa-miR-185-5p	ImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot	24763054
MIRT053767	hsa-miR-185-5p	ImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot	24763054
MIRT053767	hsa-miR-185-5p	ImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot	24763054
MIRT549357	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT549356	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT549355	hsa-miR-135b-5p	PAR-CLIP	21572407
MIRT549354	hsa-miR-135a-5p	PAR-CLIP	21572407
MIRT549353	hsa-miR-4668-3p	PAR-CLIP	21572407
MIRT549351	hsa-miR-3163	PAR-CLIP	21572407
MIRT549352	hsa-miR-889-5p	PAR-CLIP	21572407
MIRT549350	hsa-miR-455-5p	PAR-CLIP	21572407
MIRT549349	hsa-miR-7114-5p	PAR-CLIP	21572407
MIRT549348	hsa-miR-134-3p	PAR-CLIP	21572407
MIRT549347	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT549346	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT549345	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT549344	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT549343	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT549342	hsa-miR-8074	PAR-CLIP	21572407
MIRT549341	hsa-miR-548aw	PAR-CLIP	21572407
MIRT494753	hsa-miR-3141	PAR-CLIP	22012620
MIRT494752	hsa-miR-6746-5p	PAR-CLIP	22012620
MIRT529160	hsa-miR-4469	PAR-CLIP	22012620
MIRT529159	hsa-miR-2467-5p	PAR-CLIP	22012620
MIRT494750	hsa-miR-3195	PAR-CLIP	22012620
MIRT494751	hsa-miR-3960	PAR-CLIP	22012620
MIRT494749	hsa-miR-8072	PAR-CLIP	22012620
MIRT529158	hsa-miR-7106-3p	PAR-CLIP	22012620
MIRT494748	hsa-miR-4467	PAR-CLIP	22012620
MIRT494747	hsa-miR-6731-5p	PAR-CLIP	22012620
MIRT494746	hsa-miR-8085	PAR-CLIP	22012620
MIRT494753	hsa-miR-3141	PAR-CLIP	23592263
MIRT494752	hsa-miR-6746-5p	PAR-CLIP	23592263
MIRT494750	hsa-miR-3195	PAR-CLIP	23592263
MIRT494751	hsa-miR-3960	PAR-CLIP	23592263
MIRT494749	hsa-miR-8072	PAR-CLIP	23592263
MIRT494748	hsa-miR-4467	PAR-CLIP	23592263
MIRT494747	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT494746	hsa-miR-8085	PAR-CLIP	23592263
MIRT494753	hsa-miR-3141	PAR-CLIP	26701625
MIRT494750	hsa-miR-3195	PAR-CLIP	26701625
MIRT494751	hsa-miR-3960	PAR-CLIP	26701625
MIRT494748	hsa-miR-4467	PAR-CLIP	26701625
MIRT494747	hsa-miR-6731-5p	PAR-CLIP	26701625
MIRT494752	hsa-miR-6746-5p	PAR-CLIP	26701625
MIRT494749	hsa-miR-8072	PAR-CLIP	26701625
MIRT494746	hsa-miR-8085	PAR-CLIP	26701625
MIRT549357	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT549356	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT549355	hsa-miR-135b-5p	PAR-CLIP	21572407
MIRT549354	hsa-miR-135a-5p	PAR-CLIP	21572407
MIRT549353	hsa-miR-4668-3p	PAR-CLIP	21572407
MIRT549351	hsa-miR-3163	PAR-CLIP	21572407
MIRT549352	hsa-miR-889-5p	PAR-CLIP	21572407
MIRT549350	hsa-miR-455-5p	PAR-CLIP	21572407
MIRT549349	hsa-miR-7114-5p	PAR-CLIP	21572407
MIRT549348	hsa-miR-134-3p	PAR-CLIP	21572407
MIRT549347	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT549346	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT549345	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT549344	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT549343	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT549342	hsa-miR-8074	PAR-CLIP	21572407
MIRT549341	hsa-miR-548aw	PAR-CLIP	21572407
MIRT494753	hsa-miR-3141	PAR-CLIP	22012620
MIRT494752	hsa-miR-6746-5p	PAR-CLIP	22012620
MIRT529160	hsa-miR-4469	PAR-CLIP	22012620
MIRT529159	hsa-miR-2467-5p	PAR-CLIP	22012620
MIRT494750	hsa-miR-3195	PAR-CLIP	22012620
MIRT494751	hsa-miR-3960	PAR-CLIP	22012620
MIRT494749	hsa-miR-8072	PAR-CLIP	22012620
MIRT529158	hsa-miR-7106-3p	PAR-CLIP	22012620
MIRT494748	hsa-miR-4467	PAR-CLIP	22012620
MIRT494747	hsa-miR-6731-5p	PAR-CLIP	22012620
MIRT494746	hsa-miR-8085	PAR-CLIP	22012620
MIRT494753	hsa-miR-3141	PAR-CLIP	23592263
MIRT494752	hsa-miR-6746-5p	PAR-CLIP	23592263
MIRT494750	hsa-miR-3195	PAR-CLIP	23592263
MIRT494751	hsa-miR-3960	PAR-CLIP	23592263
MIRT494749	hsa-miR-8072	PAR-CLIP	23592263
MIRT494748	hsa-miR-4467	PAR-CLIP	23592263
MIRT494747	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT494746	hsa-miR-8085	PAR-CLIP	23592263
MIRT791721	hsa-miR-1205	CLIP-seq
MIRT791722	hsa-miR-1207-3p	CLIP-seq
MIRT791723	hsa-miR-1207-5p	CLIP-seq
MIRT791724	hsa-miR-1254	CLIP-seq
MIRT791725	hsa-miR-1286	CLIP-seq
MIRT791726	hsa-miR-1299	CLIP-seq
MIRT791727	hsa-miR-1587	CLIP-seq
MIRT791728	hsa-miR-18a	CLIP-seq
MIRT791729	hsa-miR-18b	CLIP-seq
MIRT791730	hsa-miR-198	CLIP-seq
MIRT791731	hsa-miR-2861	CLIP-seq
MIRT791732	hsa-miR-2964a-5p	CLIP-seq
MIRT791733	hsa-miR-3116	CLIP-seq
MIRT791734	hsa-miR-3120-5p	CLIP-seq
MIRT791735	hsa-miR-3151	CLIP-seq
MIRT791736	hsa-miR-3158-3p	CLIP-seq
MIRT791737	hsa-miR-320e	CLIP-seq
MIRT791738	hsa-miR-326	CLIP-seq
MIRT791739	hsa-miR-330-5p	CLIP-seq
MIRT791740	hsa-miR-331-3p	CLIP-seq
MIRT791741	hsa-miR-342-5p	CLIP-seq
MIRT791742	hsa-miR-3614-5p	CLIP-seq
MIRT791743	hsa-miR-3619-3p	CLIP-seq
MIRT791744	hsa-miR-3687	CLIP-seq
MIRT791745	hsa-miR-3918	CLIP-seq
MIRT791746	hsa-miR-4265	CLIP-seq
MIRT791747	hsa-miR-4283	CLIP-seq
MIRT791748	hsa-miR-4296	CLIP-seq
MIRT791749	hsa-miR-4322	CLIP-seq
MIRT791750	hsa-miR-4323	CLIP-seq
MIRT791751	hsa-miR-4417	CLIP-seq
MIRT791752	hsa-miR-4433	CLIP-seq
MIRT791753	hsa-miR-4442	CLIP-seq
MIRT791754	hsa-miR-4447	CLIP-seq
MIRT791755	hsa-miR-4455	CLIP-seq
MIRT791756	hsa-miR-4472	CLIP-seq
MIRT791757	hsa-miR-4489	CLIP-seq
MIRT791758	hsa-miR-4492	CLIP-seq
MIRT791759	hsa-miR-4498	CLIP-seq
MIRT791760	hsa-miR-4512	CLIP-seq
MIRT791761	hsa-miR-4651	CLIP-seq
MIRT791762	hsa-miR-4656	CLIP-seq
MIRT791763	hsa-miR-4664-5p	CLIP-seq
MIRT791764	hsa-miR-4667-5p	CLIP-seq
MIRT791765	hsa-miR-4675	CLIP-seq
MIRT791766	hsa-miR-4677-3p	CLIP-seq
MIRT791767	hsa-miR-4679	CLIP-seq
MIRT791768	hsa-miR-4685-5p	CLIP-seq
MIRT791769	hsa-miR-4690-3p	CLIP-seq
MIRT791770	hsa-miR-4700-5p	CLIP-seq
MIRT791771	hsa-miR-4722-5p	CLIP-seq
MIRT791772	hsa-miR-4731-5p	CLIP-seq
MIRT791773	hsa-miR-4735-3p	CLIP-seq
MIRT791774	hsa-miR-4736	CLIP-seq
MIRT791775	hsa-miR-4741	CLIP-seq
MIRT791776	hsa-miR-4763-3p	CLIP-seq
MIRT791777	hsa-miR-4764-5p	CLIP-seq
MIRT791778	hsa-miR-4776-5p	CLIP-seq
MIRT791779	hsa-miR-4782-5p	CLIP-seq
MIRT791780	hsa-miR-491-5p	CLIP-seq
MIRT791781	hsa-miR-516b	CLIP-seq
MIRT791782	hsa-miR-555	CLIP-seq
MIRT791783	hsa-miR-593	CLIP-seq
MIRT791784	hsa-miR-608	CLIP-seq
MIRT791785	hsa-miR-609	CLIP-seq
MIRT791786	hsa-miR-637	CLIP-seq
MIRT791787	hsa-miR-762	CLIP-seq
MIRT1933600	hsa-miR-2276	CLIP-seq
MIRT1933601	hsa-miR-3160-3p	CLIP-seq
MIRT1933602	hsa-miR-3184	CLIP-seq
MIRT1933603	hsa-miR-423-5p	CLIP-seq
MIRT791758	hsa-miR-4492	CLIP-seq
MIRT791759	hsa-miR-4498	CLIP-seq
MIRT1933604	hsa-miR-4633-3p	CLIP-seq
MIRT1933605	hsa-miR-4640-5p	CLIP-seq
MIRT1933606	hsa-miR-4708-3p	CLIP-seq
MIRT1933607	hsa-miR-4710	CLIP-seq
MIRT1933608	hsa-miR-4726-5p	CLIP-seq
MIRT1933609	hsa-miR-4761-5p	CLIP-seq
MIRT791787	hsa-miR-762	CLIP-seq
MIRT791723	hsa-miR-1207-5p	CLIP-seq
MIRT2173666	hsa-miR-1321	CLIP-seq
MIRT2173667	hsa-miR-3192	CLIP-seq
MIRT2173668	hsa-miR-3689a-3p	CLIP-seq
MIRT2173669	hsa-miR-3689c	CLIP-seq
MIRT2173670	hsa-miR-370	CLIP-seq
MIRT2173671	hsa-miR-4419a	CLIP-seq
MIRT2173672	hsa-miR-4510	CLIP-seq
MIRT2173673	hsa-miR-4728-5p	CLIP-seq
MIRT791772	hsa-miR-4731-5p	CLIP-seq
MIRT2173674	hsa-miR-4739	CLIP-seq
MIRT2173675	hsa-miR-4756-5p	CLIP-seq
MIRT791776	hsa-miR-4763-3p	CLIP-seq
MIRT2173676	hsa-miR-670	CLIP-seq
MIRT2384348	hsa-miR-1203	CLIP-seq
MIRT2443847	hsa-miR-1184	CLIP-seq
MIRT791721	hsa-miR-1205	CLIP-seq
MIRT2443848	hsa-miR-1909	CLIP-seq
MIRT2443849	hsa-miR-3158-5p	CLIP-seq
MIRT2443850	hsa-miR-361-3p	CLIP-seq
MIRT2443851	hsa-miR-4281	CLIP-seq
MIRT2443852	hsa-miR-4446-3p	CLIP-seq
MIRT791758	hsa-miR-4492	CLIP-seq
MIRT791759	hsa-miR-4498	CLIP-seq
MIRT2443853	hsa-miR-4527	CLIP-seq
MIRT791787	hsa-miR-762	CLIP-seq

Show/Hide all (61)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0003723	Function	RNA binding	IEA
GO:0003729	Function	MRNA binding	IDA	33175445
GO:0003729	Function	MRNA binding	IEA
GO:0003729	Function	MRNA binding	ISS
GO:0005198	Function	Structural molecule activity	IDA	33175445
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	21834987
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	21834987
GO:0005886	Component	Plasma membrane	IEA
GO:0005938	Component	Cell cortex	IEA
GO:0006897	Process	Endocytosis	IEA
GO:0007010	Process	Cytoskeleton organization	IBA
GO:0007010	Process	Cytoskeleton organization	IMP	21834987
GO:0007492	Process	Endoderm development	IEA
GO:0007616	Process	Long-term memory	IEA
GO:0007616	Process	Long-term memory	ISS
GO:0007616	Process	Long-term memory	TAS	15537891
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0014069	Component	Postsynaptic density	IEA
GO:0015629	Component	Actin cytoskeleton	IBA
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IMP	21834987
GO:0022604	Process	Regulation of cell morphogenesis	IMP	21834987
GO:0030425	Component	Dendrite	IEA
GO:0030665	Component	Clathrin-coated vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031901	Component	Early endosome membrane	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043025	Component	Neuronal cell body	TAS	15537891
GO:0043197	Component	Dendritic spine	IEA
GO:0043197	Component	Dendritic spine	ISS
GO:0045121	Component	Membrane raft	IEA
GO:0045121	Component	Membrane raft	ISS
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0048168	Process	Regulation of neuronal synaptic plasticity	IBA
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0050804	Process	Modulation of chemical synaptic transmission	ISS
GO:0051028	Process	MRNA transport	ISS
GO:0051260	Process	Protein homooligomerization	ISS
GO:0060291	Process	Long-term synaptic potentiation	TAS	15537891
GO:0060997	Process	Dendritic spine morphogenesis	TAS	15537891
GO:0061001	Process	Regulation of dendritic spine morphogenesis	ISS
GO:0071598	Component	Neuronal ribonucleoprotein granule	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099149	Process	Regulation of postsynaptic neurotransmitter receptor internalization	IEA
GO:0110077	Process	Vesicle-mediated intercellular transport	ISS
GO:0170047	Component	Virus-like capsid	IDA	33175445
GO:1900271	Process	Regulation of long-term synaptic potentiation	IBA
GO:1900271	Process	Regulation of long-term synaptic potentiation	IEA
GO:1900271	Process	Regulation of long-term synaptic potentiation	ISS
GO:1900452	Process	Regulation of long-term synaptic depression	IEA
GO:1900452	Process	Regulation of long-term synaptic depression	ISS
GO:1903561	Component	Extracellular vesicle	ISS

MIM	HGNC	e!Ensembl
612461	648	ENSG00000198576

Q7LC44

Protein name

Activity-regulated cytoskeleton-associated protein (hArc) (Activity-regulated gene 3.1 protein homolog) (ARC/ARG3.1) (Arg3.1)

Protein function

Master regulator of synaptic plasticity that self-assembles into virion-like capsids that encapsulate RNAs and mediate intercellular RNA transfer in the nervous system. ARC protein is released from neurons in extracellular vesicles that mediate

PDB

6TN7 , 6TNQ , 6TQ0 , 6YTU , 7R1Z , 7R23 , 8QF4 , 8QF5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF18162	Arc_C	278 → 360	Arc C-lobe	Domain

Sequence

MELDHRTSGGLHAYPGPRGGQVAKPNVILQIGKCRAEMLEHVRRTHRHLLAEVSKQVERE
LKGLHRSVGKLESNLDGYVPTSDSQRWKKSIKACLCRCQETIANLERWVKREMHVWREVF
YRLERWADRLESTGGKYPVGSESARHTVSVGVGGPESYCHEADGYDYTVSPYAITPPPAA
GELPGQEPAEAQQYQPWVPGEDGQPSPGVDTQIFEDPREFLSHLEEYLRQVGGSEEYWLS
QIQNHMNGPAKKWWEFKQGSVKNWVEFKKEFLQYSEGTLSREAIQRELDLPQKQGEPLDQ
FLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRFLRHPLPKTLEQLIQRGMEVQDDLE
QAAEPAGPHLPVEDEAETLTPAPNSESVASDRTQPE

Sequence length

396

Interactions

View interactions

	KEGG		Reactome
	Amphetamine addiction		NGF-stimulated transcription

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMERS DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL OR BEHAVIOURAL DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOVEMENT DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (69)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	18503570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	30244496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	28412271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age-related cortical cataract	Cortical cataract	BEFREE	22665971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	18503570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	18503570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	30386171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	18503570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	18503570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	28108859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anal carcinoma	Anal Cancer	BEFREE	31118786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	28701913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	29852309, 30761730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	29852309, 30761730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	33568645	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	33568645	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthrogryposis	Arthrogryposis multiplex congenita	BEFREE	9332665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthrogryposis, renal dysfunction, and cholestasis 1	Arthrogryposis, Renal Dysfunction, And Cholestasis	BEFREE	19274792, 24071963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28732507	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	28464919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	19479712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	17142834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	31810025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	26873854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	17999411, 20232300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17999411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	24531537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	18516683, 28464919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	17142452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29559111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	35665606	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28765602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	28539659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	27966542, 35665606	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Erythema Multiforme	Erythema	BEFREE	31845896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Etat Marbre	Status marmoratus	CTD_human_DG	20298714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	18503570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22949938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33969375	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	24531537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic generalized epilepsy	Epilepsy	BEFREE	10970730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	26873854, 30227888, 30930725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infantile Spasm	Infantile Spasms	BEFREE	29636502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis	Intrahepatic Cholestasis	BEFREE	19274792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28987854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	2238573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	31701363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30674535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	19175411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	29606887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17999411, 22949938, 29571946, 30442501, 30812066, 31000419, 31281099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	17999411, 20232300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29559111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation Autosomal Recessive 1	Intellectual developmental disorder	Pubtator	28671113	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28752053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement Disorders	CTD_human_DG	20298714		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	24531537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	17142452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20232300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	19159662, 28265338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	26817842	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28243821, 28539659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	18503570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	18516683, 28464919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	31810025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	9002042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	22083728, 26474411, 26573769, 26873854, 27464451, 28979198, 30420267		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	22083728		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
West Syndrome	West Syndrome	BEFREE	29636502		★★★★★ ★☆☆☆☆ Found in Text Mining only

ARC (activity regulated cytoskeleton associated protein)