FLT1 (fms related receptor tyrosine kinase 1)

Gene

• Entrez ID: 2321
• Gene name: Fms related receptor tyrosine kinase 1
• Gene symbol: FLT1
• Synonyms (NCBI Gene): FLT, FLT-1, VEGFR-1, VEGFR1
• Chromosome: 13
• Chromosome location: 13q12.3
• Summary: This gene encodes a member of the vascular endothelial growth factor receptor (VEGFR) family. VEGFR family members are receptor tyrosine kinases (RTKs) which contain an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a tra

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006441	hsa-miR-200b-3p	Luciferase reporter assay, Western blot	21544626
MIRT006441	hsa-miR-200b-3p	Luciferase reporter assay, Western blot	21544626
MIRT006441	hsa-miR-200b-3p	Luciferase reporter assay, Western blot	21544626
MIRT006850	hsa-miR-100-5p	Luciferase reporter assay	22955733
MIRT006850	hsa-miR-100-5p	Luciferase reporter assay	22955733
MIRT006885	hsa-miR-200c-3p	Luciferase reporter assay, Western blot	22569286
MIRT020776	hsa-miR-155-5p	qRT-PCR	21310411
MIRT006885	hsa-miR-200c-3p	Luciferase reporter assay, qRT-PCR, Western blot	22735571
MIRT608058	hsa-miR-8485	HITS-CLIP	23313552
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23313552
MIRT608056	hsa-miR-935	HITS-CLIP	23313552
MIRT608058	hsa-miR-8485	HITS-CLIP	23313552
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23313552
MIRT608056	hsa-miR-935	HITS-CLIP	23313552
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23313552
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	24906430
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	24906430
MIRT608056	hsa-miR-935	HITS-CLIP	24906430
MIRT608055	hsa-miR-582-5p	HITS-CLIP	24906430
MIRT443671	hsa-miR-371b-3p	PAR-CLIP	22100165
MIRT443670	hsa-miR-371a-3p	PAR-CLIP	22100165
MIRT443669	hsa-miR-33b-3p	PAR-CLIP	22100165
MIRT443668	hsa-miR-515-3p	PAR-CLIP	22100165
MIRT443667	hsa-miR-519e-3p	PAR-CLIP	22100165
MIRT443666	hsa-miR-5189-3p	PAR-CLIP	22100165
MIRT443664	hsa-miR-4671-3p	PAR-CLIP	22100165
MIRT443665	hsa-miR-4473	PAR-CLIP	22100165
MIRT443663	hsa-miR-6844	PAR-CLIP	22100165
MIRT006441	hsa-miR-200b-3p	Western blot	27373709
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	27418678
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	27418678
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	27418678
MIRT575422	hsa-miR-8485	HITS-CLIP	27418678
MIRT575422	hsa-miR-8485	HITS-CLIP	27418678
MIRT575422	hsa-miR-8485	HITS-CLIP	27418678
MIRT575422	hsa-miR-8485	HITS-CLIP	27418678
MIRT575422	hsa-miR-8485	HITS-CLIP	27418678
MIRT735012	hsa-miR-373-3p	Luciferase reporter assay, qRT-PCR, In situ hybridization, Flow cytometry	33093438
MIRT575422	hsa-miR-8485	HITS-CLIP	23313552
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23313552
MIRT608056	hsa-miR-935	HITS-CLIP	23313552
MIRT575422	hsa-miR-8485	HITS-CLIP	23313552
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23313552
MIRT608056	hsa-miR-935	HITS-CLIP	23313552
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23313552
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT443671	hsa-miR-371b-3p	PAR-CLIP	22100165
MIRT443670	hsa-miR-371a-3p	PAR-CLIP	22100165
MIRT443669	hsa-miR-33b-3p	PAR-CLIP	22100165
MIRT443668	hsa-miR-515-3p	PAR-CLIP	22100165
MIRT443667	hsa-miR-519e-3p	PAR-CLIP	22100165
MIRT443666	hsa-miR-5189-3p	PAR-CLIP	22100165
MIRT443664	hsa-miR-4671-3p	PAR-CLIP	22100165
MIRT443665	hsa-miR-4473	PAR-CLIP	22100165
MIRT443663	hsa-miR-6844	PAR-CLIP	22100165
MIRT999025	hsa-miR-1470	CLIP-seq
MIRT999026	hsa-miR-148a	CLIP-seq
MIRT999027	hsa-miR-148b	CLIP-seq
MIRT999028	hsa-miR-152	CLIP-seq
MIRT999029	hsa-miR-1909	CLIP-seq
MIRT999030	hsa-miR-200b	CLIP-seq
MIRT999031	hsa-miR-200c	CLIP-seq
MIRT999032	hsa-miR-224	CLIP-seq
MIRT999033	hsa-miR-2682	CLIP-seq
MIRT999034	hsa-miR-3121-3p	CLIP-seq
MIRT999035	hsa-miR-34a	CLIP-seq
MIRT999036	hsa-miR-34c-5p	CLIP-seq
MIRT999037	hsa-miR-3688-3p	CLIP-seq
MIRT999038	hsa-miR-3714	CLIP-seq
MIRT999039	hsa-miR-3919	CLIP-seq
MIRT999040	hsa-miR-429	CLIP-seq
MIRT999041	hsa-miR-449a	CLIP-seq
MIRT999042	hsa-miR-449b	CLIP-seq
MIRT999043	hsa-miR-449c	CLIP-seq
MIRT999044	hsa-miR-4691-5p	CLIP-seq
MIRT999045	hsa-miR-4713-3p	CLIP-seq
MIRT999046	hsa-miR-4713-5p	CLIP-seq
MIRT999047	hsa-miR-491-3p	CLIP-seq
MIRT999048	hsa-miR-1307	CLIP-seq
MIRT999049	hsa-miR-4638-5p	CLIP-seq
MIRT999050	hsa-miR-4772-3p	CLIP-seq
MIRT999030	hsa-miR-200b	CLIP-seq
MIRT999031	hsa-miR-200c	CLIP-seq
MIRT999051	hsa-miR-30a	CLIP-seq
MIRT999052	hsa-miR-30b	CLIP-seq
MIRT999053	hsa-miR-30c	CLIP-seq
MIRT999054	hsa-miR-30d	CLIP-seq
MIRT999055	hsa-miR-30e	CLIP-seq
MIRT999056	hsa-miR-33a	CLIP-seq
MIRT999057	hsa-miR-33b	CLIP-seq
MIRT999058	hsa-miR-369-3p	CLIP-seq
MIRT999059	hsa-miR-4265	CLIP-seq
MIRT999040	hsa-miR-429	CLIP-seq
MIRT999060	hsa-miR-4296	CLIP-seq
MIRT999061	hsa-miR-4322	CLIP-seq
MIRT999062	hsa-miR-578	CLIP-seq
MIRT999063	hsa-miR-581	CLIP-seq
MIRT999064	hsa-miR-586	CLIP-seq
MIRT1996042	hsa-miR-4279	CLIP-seq
MIRT1996043	hsa-miR-1178	CLIP-seq
MIRT1996044	hsa-miR-1245	CLIP-seq
MIRT1996045	hsa-miR-136	CLIP-seq
MIRT1996046	hsa-miR-1972	CLIP-seq
MIRT1996047	hsa-miR-3194-5p	CLIP-seq
MIRT1996048	hsa-miR-4650-5p	CLIP-seq
MIRT1996049	hsa-miR-4676-5p	CLIP-seq
MIRT1996050	hsa-miR-575	CLIP-seq
MIRT999025	hsa-miR-1470	CLIP-seq
MIRT2230109	hsa-miR-3120-3p	CLIP-seq
MIRT2230110	hsa-miR-3124-3p	CLIP-seq
MIRT2230111	hsa-miR-4276	CLIP-seq
MIRT2230112	hsa-miR-4302	CLIP-seq
MIRT999046	hsa-miR-4713-5p	CLIP-seq
MIRT2230113	hsa-miR-4756-3p	CLIP-seq
MIRT2230114	hsa-miR-548t	CLIP-seq
MIRT2230115	hsa-miR-595	CLIP-seq
MIRT2230116	hsa-miR-648	CLIP-seq
MIRT2388020	hsa-miR-4780	CLIP-seq
MIRT2388021	hsa-miR-623	CLIP-seq
MIRT2449782	hsa-miR-1254	CLIP-seq
MIRT2449783	hsa-miR-1272	CLIP-seq
MIRT2449784	hsa-miR-1297	CLIP-seq
MIRT2449785	hsa-miR-1322	CLIP-seq
MIRT2449786	hsa-miR-1343	CLIP-seq
MIRT2449787	hsa-miR-1976	CLIP-seq
MIRT2449788	hsa-miR-26a	CLIP-seq
MIRT2449789	hsa-miR-26b	CLIP-seq
MIRT2449790	hsa-miR-3116	CLIP-seq
MIRT2449791	hsa-miR-3149	CLIP-seq
MIRT739478	hsa-miR-3682-3p	CLIP-seq
MIRT1996042	hsa-miR-4279	CLIP-seq
MIRT2449792	hsa-miR-4421	CLIP-seq
MIRT2449793	hsa-miR-4465	CLIP-seq
MIRT2449794	hsa-miR-4735-5p	CLIP-seq
MIRT2449795	hsa-miR-4740-3p	CLIP-seq
MIRT2449796	hsa-miR-4775	CLIP-seq
MIRT2449797	hsa-miR-4794	CLIP-seq
MIRT2449798	hsa-miR-590-3p	CLIP-seq
MIRT2449799	hsa-miR-661	CLIP-seq
MIRT2533954	hsa-miR-122	CLIP-seq
MIRT2449782	hsa-miR-1254	CLIP-seq
MIRT2449783	hsa-miR-1272	CLIP-seq
MIRT2533955	hsa-miR-139-3p	CLIP-seq
MIRT2449790	hsa-miR-3116	CLIP-seq
MIRT2533956	hsa-miR-3135b	CLIP-seq
MIRT2449791	hsa-miR-3149	CLIP-seq
MIRT2533957	hsa-miR-3652	CLIP-seq
MIRT739478	hsa-miR-3682-3p	CLIP-seq
MIRT2533958	hsa-miR-4423-5p	CLIP-seq
MIRT2533959	hsa-miR-4430	CLIP-seq
MIRT2449794	hsa-miR-4735-5p	CLIP-seq
MIRT2449796	hsa-miR-4775	CLIP-seq
MIRT2449797	hsa-miR-4794	CLIP-seq
MIRT2449798	hsa-miR-590-3p	CLIP-seq
MIRT2533960	hsa-miR-633	CLIP-seq
MIRT2449799	hsa-miR-661	CLIP-seq
MIRT2449782	hsa-miR-1254	CLIP-seq
MIRT2449790	hsa-miR-3116	CLIP-seq
MIRT2449791	hsa-miR-3149	CLIP-seq
MIRT2681048	hsa-miR-4312	CLIP-seq
MIRT2449794	hsa-miR-4735-5p	CLIP-seq
MIRT2449796	hsa-miR-4775	CLIP-seq
MIRT2449797	hsa-miR-4794	CLIP-seq
MIRT2449798	hsa-miR-590-3p	CLIP-seq
MIRT2533960	hsa-miR-633	CLIP-seq
MIRT2449799	hsa-miR-661	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ATF1	Unknown	7499271
CREB1	Unknown	7499271
E2F1	Unknown	20516113
EGR1	Unknown	10828020
EPAS1	Activation	15192019;19616846
ESR1	Unknown	17242190
ETS1	Unknown	10554042
TP53	Activation	16432214
TP53	Unknown	1724219e

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0002040	Process	Sprouting angiogenesis	IBA
GO:0002548	Process	Monocyte chemotaxis	IDA	8605350, 18079407
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IEA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	TAS	8248162
GO:0005021	Function	Vascular endothelial growth factor receptor activity	IBA
GO:0005021	Function	Vascular endothelial growth factor receptor activity	IDA	1312256, 8605350, 9299537, 15952180
GO:0005021	Function	Vascular endothelial growth factor receptor activity	IEA
GO:0005021	Function	Vascular endothelial growth factor receptor activity	IMP	11312102
GO:0005021	Function	Vascular endothelial growth factor receptor activity	TAS	10748050
GO:0005515	Function	Protein binding	IPI	1312256, 7657594, 9393862, 10543948, 12771128, 14684734, 16893970, 18273061, 20660291, 21596751, 23397142, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	8248162
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	11513746
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8248162
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006935	Process	Chemotaxis	IEA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	TAS	2158038
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	10748050
GO:0015629	Component	Actin cytoskeleton	IDA
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016477	Process	Cell migration	IBA
GO:0016477	Process	Cell migration	IMP	8605350
GO:0016740	Function	Transferase activity	IEA
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IDA	9299537, 11513746
GO:0019838	Function	Growth factor binding	IBA
GO:0019838	Function	Growth factor binding	IPI	1312256, 10471394, 11513746, 12366396, 16109918
GO:0030154	Process	Cell differentiation	IEA
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0030335	Process	Positive regulation of cell migration	IDA	8605350
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IDA	8605350
GO:0036323	Process	Vascular endothelial growth factor receptor-1 signaling pathway	IDA	15952180
GO:0036332	Function	Placental growth factor receptor activity	IDA	12796773
GO:0038084	Process	Vascular endothelial growth factor signaling pathway	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0043235	Component	Receptor complex	IBA
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0043406	Process	Positive regulation of MAP kinase activity	IDA	9299537
GO:0043410	Process	Positive regulation of MAPK cascade	IBA
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	9299537
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IMP	14633857, 28637396
GO:0046777	Process	Protein autophosphorylation	IDA	9299537, 11513746
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IBA
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IDA	1312256, 9299537
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IEA
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IMP	11312102
GO:0048514	Process	Blood vessel morphogenesis	ISS
GO:0048598	Process	Embryonic morphogenesis	ISS
GO:0051094	Process	Positive regulation of developmental process	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	14633857
GO:1905563	Process	Negative regulation of vascular endothelial cell proliferation	IGI	22955733
GO:1990384	Process	Hyaloid vascular plexus regression	ISS

Other IDs

• MIM: 165070
• HGNC: 3763
• e!Ensembl: ENSG00000102755

Protein

• UniProt ID: P17948
• Protein name: Vascular endothelial growth factor receptor 1 (VEGFR-1) (EC 2.7.10.1) (Fms-like tyrosine kinase 1) (FLT-1) (Tyrosine-protein kinase FRT) (Tyrosine-protein kinase receptor FLT) (FLT) (Vascular permeability factor receptor)
• Protein function: Tyrosine-protein kinase that acts as a cell-surface receptor for VEGFA, VEGFB and PGF, and plays an essential role in the development of embryonic vasculature, the regulation of angiogenesis, cell survival, cell migration, macrophage function, c
• PDB: 1FLT, 1QSV, 1QSZ, 1QTY, 1RV6, 2XAC, 3HNG, 4CKV, 4CL7, 5ABD, 5EX3, 5T89
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00047	ig	235 → 326	Immunoglobulin domain	Domain
  PF07679	I-set	337 → 426	Immunoglobulin I-set domain	Domain
  PF13927	Ig_3	560 → 640		Domain
  PF07679	I-set	661 → 748	Immunoglobulin I-set domain	Domain
  PF17988	VEGFR-2_TMD	753 → 787	VEGFR-2 Transmembrane domain	Domain
  PF07714	PK_Tyr_Ser-Thr	827 → 1154	Protein tyrosine and serine/threonine kinase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in normal lung, but also in placenta, liver, kidney, heart and brain tissues. Specifically expressed in most of the vascular endothelial cells, and also expressed in peripheral blood monocytes. Isoform 2 is strongly expressed
• Sequence:

  MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHK
  WSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKET
  ESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPD
  GKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPV
  KLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDK
  MQNKDKGLYTCRVRSGPSFKSVNTSVHIYDKAFITVKHRKQQVLETVAGKRSYRLSMKVK
  AFPSPEVVWLKDGLPATEKSARYLTRGYSLIIKDVTEEDAGNYTILLSIKQSNVFKNLTA
  TLIVNVKPQIYEKAVSSFPDPALYPLGSRQILTCTAYGIPQPTIKWFWHPCNHNHSEARC
  DFCSNNEESFILDADSNMGNRIESITQRMAIIEGKNKMASTLVVADSRISGIYICIASNK
  VGTVGRNISFYITDVPNGFHVNLEKMPTEGEDLKLSCTVNKFLYRDVTWILLRTVNNRTM
  HYSISKQKMAITKEHSITLNLTIMNVSLQDSGTYACRARNVYTGEEILQKKEITIRDQEA
  PYLLRNLSDHTVAISSSTTLDCHANGVPEPQITWFKNNHKIQQEPGIILGPGSSTLFIER
  VTEEDEGVYHCKATNQKGSVESSAYLTVQGTSDKSNLELITLTCTCVAATLFWLLLTLFI
  RKMKRSSSEIKTDYLSIIMDPDEVPLDEQCERLPYDASKWEFARERLKLGKSLGRGAFGK
  VVQASAFGIKKSPTCRTVAVKMLKEGATASEYKALMTELKILTHIGHHLNVVNLLGACTK
  QGGPLMVIVEYCKYGNLSNYLKSKRDLFFLNKDAALHMEPKKEKMEPGLEQGKKPRLDSV
  TSSESFASSGFQEDKSLSDVEEEEDSDGFYKEPITMEDLISYSFQVARGMEFLSSRKCIH
  RDLAARNILLSENNVVKICDFGLARDIYKNPDYVRKGDTRLPLKWMAPESIFDKIYSTKS
  DVWSYGVLLWEIFSLGGSPYPGVQMDEDFCSRLREGMRMRAPEYSTPEIYQIMLDCWHRD
  PKERPRFAELVEKLGDLLQANVQQDGKDYIPINAILTGNSGFTYSTPAFSEDFFKESISA
  PKFNSGSSDDVRYVNAFKFMSLERIKTFEELLPNATSMFDDYQGDSSTLLASPMLKRFTW
  TDSKPKASLKIDLRVTSKSKESGLSDVSRPSFCHSSCGHVSEGKRRFTYDHAELERKIAC
  CSPPPDYNSVVLYSTPPI

• Sequence length: 1338

Pathways

KEGG:

MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
HIF-1 signaling pathway
PI3K-Akt signaling pathway
Focal adhesion
Transcriptional misregulation in cancer
Rheumatoid arthritis

Reactome:

Neurophilin interactions with VEGF and VEGFR
VEGF binds to VEGFR leading to receptor dimerization

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHOPULMONARY DYSPLASIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma of colon	not provided; Benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, RENAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL HEMORRHAGE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL ANOMALY OF CARTILAGE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EXUDATIVE AGE-RELATED MACULAR DEGENERATION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FLT1-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMANGIOSARCOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LARGE ARTERY STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung adenocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOYAMOYA DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOCHONDRODYSPLASIAS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRE-ECLAMPSIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PREECLAMPSIA	—	GWAS catalog, Orphanet GWAS catalog, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UREMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	30111293		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	16249383, 23503608		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	15651075, 16146532, 16249383		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	12094254, 19342098, 30508668		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	16465716, 26674118		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	16685275		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	21751195, 26014353		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	21115742		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	10893635		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	14659975, 24390213, 26359261		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	15651075, 16146532, 16249383		★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	12036858		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	31237123		★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	9669344		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	12597922, 18368052, 20609706, 24812550, 26914796, 28918058, 28949775		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	26082458, 30576228, 32989152, 36905877, 39334869, 39752902	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	31332262	Stimulate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	Pubtator	39752902	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	37012663	Stimulate	★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	36435742	Associate	★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	16968331	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	31741324		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic valve disease	Pubtator	14760594	Associate	★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	30771115		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	19948974, 20821246, 24048373, 26394773		★☆☆☆☆ Found in Text Mining only
Arteriovenous Malformations, Cerebral	Cerebral arteriovenous malformation	BEFREE	28325846		★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	31864394	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	17393418, 20108506, 28323906, 30767867	Associate	★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	10820274		★☆☆☆☆ Found in Text Mining only
Asphyxia Neonatorum	Postnatal asphyxia	BEFREE	12592265		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	26869672		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	11305411		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	26627848	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	19948974, 20821246, 24048373, 26394773		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	24767250, 29845231		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	34918882	Stimulate	★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	10893635		★☆☆☆☆ Found in Text Mining only
Beta thalassemia intermedia	beta Thalassemia	BEFREE	28301910		★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	28668864		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	23749886		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	29149180	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	11029398, 11279416	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	16523449, 28787127		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	27926948	Associate	★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	22438952		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11212228, 11306513, 15173272, 16671089, 17550303, 18630531, 21119072, 22315135, 23113927, 23716179, 23776453, 23832257, 23904188, 25202046, 25604142, 26124351, 26861455, 27167339, 27357606, 27988457, 28481877, 29970903, 29987617, 30063723, 30543720, 30560942, 30692100, 31601121, 31832803, 8616842		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	23146280, 26124351		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	10360672, 18630531, 18715621, 21119072, 23832257, 25202046, 25604142, 25971960, 27357606, 29728589, 30063723, 34793664	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	23113927	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	11141500, 20027224, 20205278, 25895461	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	23339006	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12209972		★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	21606203	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21345006, 23397142, 23737988, 26551737, 28358369, 33673041	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	23749886, 9823778		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	27075652		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24891316, 30972546		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	11846206, 18041056, 28754676, 29202733, 30852945, 34870494, 37657024	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22355056	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	25895461	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	9823778	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	23318994		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	11448924, 11929819, 19050699, 20865022, 23548101, 27943222, 31200683		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	11029398, 33988313, 36435742	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	33988313	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	20921624, 29783932		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	27736948, 30423812, 33988313, 39762845	Associate	★☆☆☆☆ Found in Text Mining only
CATARACT, MARNER TYPE	Cataract	BEFREE	12454810		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	28060742		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	33712886	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	28072723		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	28072723		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	15651075, 16146532, 16249383		★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	9669344		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	20565817, 23704979		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	20565817, 23704979, 35558087	Associate	★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	31240525		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	10068204, 10831117, 28322131, 30478339		★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG	16596207		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	32260158	Stimulate	★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	29915853		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	24048373, 25524550, 29783932, 29937525		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	11880308		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	16959214		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	24891316		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	30409304		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	17696935		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	31332262, 39752902	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30579252		★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG	16596207		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	23794399, 25880726, 31717527		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	23794399		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	12754739, 15993897, 16685275, 17214745, 19936766, 20205278, 22735571, 23794399, 24908415, 25139485, 26041938, 26537064, 27798786, 28742793, 29100318, 29571649, 30423986, 31177854, 31330410		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16685275, 17214745, 17970067, 20205278, 20222950, 23580180, 23799978, 23831629, 24908415, 25880726, 26072521, 26537064, 27049304, 28468595, 30423986, 31717527, 34470574, 36264073	Associate	★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	28325846		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	19342098		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	31744542		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11846206, 15126877, 18041056, 27417418, 28664385, 30895194, 31496820		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	16596207		★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal Neovascularization	BEFREE	30574658, 31117124		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	20116810, 26791355		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	21679057, 23364394, 26791355, 27736948, 31744542		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASDB_DG	23202125		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	27736948	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	28714975, 29212778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	16139132	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	GWASDB_DG	23364394		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	GWASCAT_DG	23364394		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	26791355		★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	29027018		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	17481912		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	15781004, 17393418		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	30054439		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	36421848	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28314760, 29427700		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	20674013, 28817576	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	16139132	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28060742, 28314760, 29427700		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	34149611	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28732797, 29305395		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	11499563, 15610240	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	15610240		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	15610240		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	12597922, 28931763		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	32836220	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	29207605, 31237123		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	26513650		★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	7821921		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	7821921		★☆☆☆☆ Found in Text Mining only
Dyschondroplasias	Dyschondroplasias	CTD_human_DG	17954590		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	25524550		★☆☆☆☆ Found in Text Mining only
Dyssomnias	Dyssomnia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	17601412, 21810232, 28109704, 28600845		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	31322068		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	23051953	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	31322068	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	26773192, 31065021		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	26773192	Associate	★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	31383782	Associate	★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	9669344		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	31200683		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	22484977		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	22484977		★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	20609706, 28926193		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial medullary thyroid carcinoma	Medullary thyroid carcinoma	BEFREE	23780998		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	29305395		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	15221961, 22130503		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	CTD_human_DG	11981751		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	14605010, 16260429		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	22842485		★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	21751195		★☆☆☆☆ Found in Text Mining only
Gastrointestinal carcinoma	Gastrointestinal carcinoma	BEFREE	19755510		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	19755510	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	17036392	Associate	★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	8760299		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingival diseases	Pubtator	29149180	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	12451475, 12918061, 15015778, 24625025, 25680186, 28560064, 28797294, 30144594, 7525492		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21691733, 28797294, 31991805, 36043525, 36941554	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	12451475, 15015778, 24625025, 25680186, 27705944, 28560064, 28797294, 30144594, 7525492		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10616207, 15221961, 23423309, 27688473, 28000842, 29025978, 29393392, 8586468		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	10682677, 27385209, 27613831, 8774132	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	32790760	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	20609706, 24812550, 26914796		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	11172289		★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	10780661	Associate	★☆☆☆☆ Found in Text Mining only
Headache	Headache	Pubtator	32929141	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	33988313	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	28652462	Inhibit	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	28652462, 36435742	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31744542		★☆☆☆☆ Found in Text Mining only
Heart Septal Defects Ventricular	Congenital heart septal defect	Pubtator	30423812	Associate	★☆☆☆☆ Found in Text Mining only
HELLP Syndrome	HELLP Syndrome	BEFREE	20541258, 25583406		★☆☆☆☆ Found in Text Mining only
Hemangioblastoma	Hemangioblastoma	BEFREE	29027018, 8930647		★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	LHGDN	18287964		★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	18931684, 21689017		★☆☆☆☆ Found in Text Mining only
Hemangioma capillary infantile	Capillary infantile hemangioma	Pubtator	18287964, 18931684, 29664206	Associate	★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	CTD_human_DG	17569031		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemangiosarcoma	Hemangiosarcoma	Pubtator	20949568	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemangiosarcoma	Hemangiosarcoma	BEFREE	31252633		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	24183807		★☆☆☆☆ Found in Text Mining only
Hemolysis	Hemolysis	Pubtator	11943725	Inhibit	★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	22563920	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary hemorrhagic telangiectasia	Hereditary Hemorrhagic Telangiectasia	BEFREE	30571259		★☆☆☆☆ Found in Text Mining only
Hyperalgesia	Hyperalgesia	Pubtator	35354377	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	26394773		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29351188		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	29351188	Associate	★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	26861455		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	17105340, 29466360, 37178326, 37561089	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	11463761, 21518965, 27139155, 29138037, 29629873, 30255752, 30354494		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	18270456, 23788753, 29351188, 33599733	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21641407, 25583406, 34665260	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	20169144	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	30354494		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	19834490		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	31332262		★☆☆☆☆ Found in Text Mining only
Infantile hemangioma	Hemangioma	BEFREE	18287964, 18931684, 29664206		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	26149656		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	11499563	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	21640973		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	36555698	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	23063127		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	19197998	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30955944		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	29915853		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	27075652	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	17036392	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	25340839	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	12529660, 16249383, 19342098, 23503608, 27838340, 30771115		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	15651075, 16249383, 22566481, 26308964, 31834935	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	16249383		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	12036858, 16249383, 17420287, 19463770, 23509773, 9058706	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	11222390	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	12094254, 12691136, 17420287, 17446561, 19342098, 21209384, 26674118, 28043794, 28916904, 30508668, 9058706		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	29976150		★☆☆☆☆ Found in Text Mining only
Lipoid nephrosis	Lipoid Nephrosis	BEFREE	10553496		★☆☆☆☆ Found in Text Mining only
Liposarcoma, Myxoid	liposarcoma	BEFREE	20515481		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11115828, 11764072, 15809749, 18924243, 22294840, 23737988, 26551737, 28401015, 28849176, 30674871, 31173855		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	16786116		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	CTD_human_DG	11981751		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver Cirrhosis	BEFREE	17696935		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver cirrhosis	Pubtator	33673041	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Failure	Liver failure	LHGDN	17964871		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	22294840		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	22795057	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	30566445		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17661207		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22593690, 30674935	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	32929141	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	14760936		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	17486129, 19385972, 23113927	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23737988	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	15311211, 17998899, 19821819	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	12607599		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	28949775, 33599733, 33604378, 37862026	Associate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	35370941	Stimulate	★☆☆☆☆ Found in Text Mining only
Macular retinal edema	Macular edema	LHGDN	18421240		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	27688473		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	11493335		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11212228, 11241411, 11306513, 15173272, 17550303, 18630531, 21119072, 22315135, 23113927, 23716179, 23776453, 23832257, 23904188, 25202046, 25604142, 26124351, 26261265, 26861455, 27167339, 27357606, 27988457, 28481877, 29970903, 29987617, 30063723, 30543720, 30692100, 31562866, 31601121, 31832803		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	23146280, 26124351		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	31322068		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	28186102		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	19755510		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	19906926		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24891316, 30972546, 31185349		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	29976150		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11448924, 11929819, 19050699, 20865022, 23548101, 27943222		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	12142732, 12192562, 17409437, 23421954, 27965135, 29481086		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12824880, 15564138, 25894226, 26450920, 30575560		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	CTD_human_DG	19718025		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	12439912, 15150121, 23801279, 24398900, 29916721		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	23749886, 9823778		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12192562, 14607330, 15359287, 16336962, 16432214, 17486129, 20723540, 21504321, 21558755, 22395469, 22484977, 23749886, 23801279, 24165321, 24306423, 25894226, 25895458, 26041938, 27049304, 27324368, 27705944, 27770160, 27783849, 28220020, 28358369, 28560064, 29100318, 29198078, 29476002, 29521047, 29693502, 29938937, 30217739, 30251659, 30605747, 30705592, 31173855, 31322068, 31601121		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	28072723		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	23794399, 24625025, 25880726, 31717527		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	23146280, 26124351		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11888889, 16671089, 17550303, 18284215		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17550303		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	23146280, 26124351		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	23146280, 26124351		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	23780998		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	17704359, 29377550	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10886518, 11121133, 20004943, 24868139, 31758648, 7744769	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	BEFREE	10937546, 11438469, 17230507, 19718025, 21109946, 21212411, 21389833, 26846845, 28481877, 31758648		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	LHGDN	15166498, 15610528		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	CTD_human_DG	19718025		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melnick-Needles Syndrome	Melnick-Needles Syndrome	CTD_human_DG	17954590		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	31213381		★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	26149656		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	11493335		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	19505392	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29305395		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	28939845		★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular angina	Pubtator	34966385	Stimulate	★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	30771115		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	21071334, 29221937		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	LHGDN	11839635		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	15470196		★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	16444749, 24714697		★☆☆☆☆ Found in Text Mining only
Multiple Epiphyseal Dysplasia	Multiple Epiphyseal Dysplasia	CTD_human_DG	17954590		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	14513053, 17622469		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	14644994	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	16959214		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	27424135	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	18604718, 30771115		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	LHGDN	18604718		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	12100142	Associate	★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	21217153, 28360204		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	LHGDN	15183893		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	21360018, 24183807		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	21217153		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	20019242, 25738804, 29158084		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	24306423, 28091565		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	36822023	Stimulate	★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	31383782		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10490819, 10616207, 10661874, 10682677, 11221852, 11241411, 11274374, 11306510, 11764072, 11772947, 11846206, 11888889, 12142732, 12439912, 12754739, 14605010, 14659975, 15015778, 15107801, 15221961, 15564138, 15771958, 15809749, 16530326, 16671089, 16754748, 16885362, 16982761, 16997614, 17006982, 17230507, 17308112, 17409437, 17550303, 17570036, 18630531, 18720430, 19075670, 19249018, 19584166, 20179233, 20205278, 20515481, 20720035, 20723540, 20978198, 21070749, 21212411, 21224376, 21245090, 21531285, 21537838, 21548585, 21709213, 21989163, 22156924, 22438952, 22484977, 22735808, 22815044, 23113927, 23144318, 23146280, 23226334, 23341544, 23423309, 23548101, 23554961, 23716179, 23717468, 23776453, 23794399, 23799978, 23902770, 23991063, 24622808, 24625025, 24759089, 24891316, 24908415, 25052479, 25202046, 25641339, 25680186, 25880726, 26826105, 26861455, 27041693, 27357606, 27791295, 27798786, 27940520, 28000842, 28042315, 28091565, 28186102, 28220020, 28284101, 28423599, 28718364, 28795252, 28971330, 29025978, 29055019, 29097919, 29262608, 29332233, 29474747, 29490919, 29512738, 29571649, 29594931, 29618618, 29749553, 29756310, 29791503, 29794225, 29987617, 30063723, 30104711, 30170190, 30266802, 30406513, 30483898, 30543720, 30700502, 30959352, 30985194, 31185349, 31239322, 31240525, 31330410, 31482415, 31601121, 31758648, 7525492, 7535799, 8667614, 8930647, 9671758, 9777955, 9823778		★☆☆☆☆ Found in Text Mining only
Nephrosis Lipoid	Nephrotic syndrome	Pubtator	22977664	Associate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	23063127		★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	LHGDN	17570036		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11815985, 20179233, 25288151		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	11815985, 20179233	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	39752902	Associate	★☆☆☆☆ Found in Text Mining only
Neuroferritinopathy	Neuroferritinopathy	BEFREE	26149656		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	17570036		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16530326, 16624341, 17599955, 24970910, 25052479, 25773840, 26134224, 27655645, 28572289, 29594931, 29618618, 29991059, 31829270		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	7821921		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	15298982, 29244802	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	21555675, 29305395		★☆☆☆☆ Found in Text Mining only
Oculocerebrorenal Syndrome	Oculocerebrorenal syndrome	Pubtator	11943725	Associate	★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	9669344		★☆☆☆☆ Found in Text Mining only
OSLER-RENDU-WEBER SYNDROME 2	Telangiectasia, hereditary hemorrhagic	BEFREE	30571259		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	19303468, 31257478, 32384383	Associate	★☆☆☆☆ Found in Text Mining only
Osteochondrodysplasias	Osteochondrodysplasia	CTD_human_DG	17954590		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	BEFREE	18636145, 24759089, 29474747		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	29474747	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	11448924, 19050699		★☆☆☆☆ Found in Text Mining only
Ovarian Cysts	Ovarian Cysts	LHGDN	18037256		★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian Hyperstimulation Syndrome	LHGDN	16488907		★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian Hyperstimulation Syndrome	BEFREE	24851136		★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian hyperstimulation syndrome	Pubtator	24851136, 28820403	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	11929819, 20865022, 23548101, 27943222, 31200683, 8667614		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	16835828		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	24909162, 26260910, 31200683, 33235818, 33713666	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11274374, 12142732, 12192562, 17409437, 23421954, 27965135, 29481086		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	18665074		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	15952180, 16532435, 20367641, 28338114	Associate	★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	30771115		★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG	16596207		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	16260429, 16712675		★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	24390213, 26359261		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	27974423		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	22563920	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	23585849	Inhibit	★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	12368197	Stimulate	★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	14659975, 24390213, 26359261		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	24675699	Associate	★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	27886182		★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	9255258		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	31115532	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	21217153		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	16249383		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	18829111		★☆☆☆☆ Found in Text Mining only
Preeclampsia	Preeclampsia	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Presenile dementia	Senile Dementia	BEFREE	30054439		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	21217153, 28360204		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	27886182		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10893635, 12824880, 15564138, 25894226, 26450920, 30575560		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	11330643	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	10893635		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12824880		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12824880, 19385972, 21652578, 25894226	Associate	★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	19168169	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	14962110		★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	15885787		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	15681497	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31176171		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	23794399, 25899481		★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	BEFREE	23794399		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11846206, 15126877, 18041056, 19906926, 28330784, 28664385, 31496820		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	16596207		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	18566400		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	22977664	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Vein Occlusion	Retinal Vein Occlusion	BEFREE	28931763		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	20860824	Associate	★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	12840058, 20697002, 28573924		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	16077930		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	16336962, 17393418, 19180491, 26922678, 28323906, 30767867		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	19741061, 28853043, 9463589		★☆☆☆☆ Found in Text Mining only
Sarcoidosis Pulmonary	Sarcoidosis	Pubtator	20169144	Inhibit	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	11213831, 22304008		★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	16596207		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	28117656		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	28117656	Associate	★☆☆☆☆ Found in Text Mining only
Schwartz-Jampel Syndrome	Schwartz-Jampel Syndrome	CTD_human_DG	17954590		★☆☆☆☆ Found in Text Mining only
Schwartz-Jampel Syndrome, Type 1	Chondrodystrophic myotonia	CTD_human_DG	17954590		★☆☆☆☆ Found in Text Mining only
secondary acute myeloid leukemia	Myeloid leukemia	BEFREE	9058706		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	10815937, 18086000, 22139032		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	31982041	Associate	★☆☆☆☆ Found in Text Mining only
SHWACHMAN-DIAMOND SYNDROME 1	Shwachman-Diamond Syndrome	BEFREE	15368588		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	CTD_human_DG	19718025		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Disorders	Sleep Disorders	HPO_DG			★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	31441580		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	31199602	Associate	★☆☆☆☆ Found in Text Mining only
Spastic paraplegia 11 autosomal recessive	Spastic paraplegia	Pubtator	9823778	Associate	★☆☆☆☆ Found in Text Mining only
Spondyloepiphyseal Dysplasia	Spondyloepiphyseal dysplasia	CTD_human_DG	17954590		★☆☆☆☆ Found in Text Mining only
Spondyloepiphyseal Dysplasia Tarda, X-Linked	Spondyloenchondrodysplasia	CTD_human_DG	17954590		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10616207, 19834490, 28521433		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22203933, 26666815, 28718364, 29149180	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28521433, 28718364		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29305395		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12439912, 15150121, 23801279, 24398900, 29916721		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12439912, 17486129, 17659711, 19068081, 23364970, 24398900	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	18451223, 18609713		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	28197324		★☆☆☆☆ Found in Text Mining only
Strawberry nevus of skin	Strawberry Nevus Of Skin	BEFREE	18287964, 18931684, 29664206		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	33712886	Stimulate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	18975312		★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	9823778		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular Neoplasms	BEFREE	8760299		★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	21217153		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	30678450	Associate	★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	18061661		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29791503		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36822023	Associate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	21224066		★☆☆☆☆ Found in Text Mining only
TUBEROUS SCLEROSIS 1 (disorder)	Tuberous Sclerosis	BEFREE	21224066		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	21115119, 30579252		★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	CTD_human_DG	19092814		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	9823778	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25674215, 28072723, 31289124	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	24868139	Associate	★☆☆☆☆ Found in Text Mining only
Van Buchem disease	Van Buchem Disease	CTD_human_DG	17954590		★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	14760594	Associate	★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	14760594		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	24316428, 29466360, 32260307, 32713274, 36555698	Associate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	39752902	Associate	★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	11772947		★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	9669344		★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	12560388	Associate	★☆☆☆☆ Found in Text Mining only