Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	23194
Gene name	F-box and leucine rich repeat protein 7
Gene symbol	FBXL7
Synonyms (NCBI Gene)	FBL6FBL7
Chromosome	5
Chromosome location	5p15.1
Summary	This gene encodes a member of the F-box protein family which is characterized by a 42-48 amino acid motif, the F-box, which binds to the S-phase kinase-associated protein 1 (Skp1) protein. The F-box proteins constitute one of the four subunits of E3 ubiqu

205

Show/Hide all (205)

miRTarBase ID	miRNA	Experiments	Reference
MIRT537453	hsa-miR-106a-5p	PAR-CLIP	22012620
MIRT537452	hsa-miR-106b-5p	PAR-CLIP	22012620
MIRT537451	hsa-miR-17-5p	PAR-CLIP	22012620
MIRT537450	hsa-miR-20a-5p	PAR-CLIP	22012620
MIRT537449	hsa-miR-20b-5p	PAR-CLIP	22012620
MIRT537448	hsa-miR-519d-3p	PAR-CLIP	22012620
MIRT537447	hsa-miR-526b-3p	PAR-CLIP	22012620
MIRT537446	hsa-miR-93-5p	PAR-CLIP	22012620
MIRT537445	hsa-miR-302a-3p	PAR-CLIP	22012620
MIRT537444	hsa-miR-302b-3p	PAR-CLIP	22012620
MIRT537443	hsa-miR-302c-3p	PAR-CLIP	22012620
MIRT537442	hsa-miR-302d-3p	PAR-CLIP	22012620
MIRT537441	hsa-miR-302e	PAR-CLIP	22012620
MIRT537440	hsa-miR-372-3p	PAR-CLIP	22012620
MIRT537439	hsa-miR-373-3p	PAR-CLIP	22012620
MIRT537438	hsa-miR-520a-3p	PAR-CLIP	22012620
MIRT537437	hsa-miR-520b	PAR-CLIP	22012620
MIRT537436	hsa-miR-520c-3p	PAR-CLIP	22012620
MIRT537435	hsa-miR-520d-3p	PAR-CLIP	22012620
MIRT537434	hsa-miR-520e	PAR-CLIP	22012620
MIRT537433	hsa-miR-5579-5p	PAR-CLIP	22012620
MIRT537432	hsa-miR-4461	PAR-CLIP	22012620
MIRT537431	hsa-miR-520g-3p	PAR-CLIP	22012620
MIRT537430	hsa-miR-520h	PAR-CLIP	22012620
MIRT537429	hsa-miR-219a-1-3p	PAR-CLIP	22012620
MIRT537428	hsa-miR-571	PAR-CLIP	22012620
MIRT537427	hsa-miR-31-3p	PAR-CLIP	22012620
MIRT537426	hsa-miR-5681b	PAR-CLIP	22012620
MIRT537425	hsa-miR-518a-5p	PAR-CLIP	22012620
MIRT537424	hsa-miR-527	PAR-CLIP	22012620
MIRT537423	hsa-miR-3912-5p	PAR-CLIP	22012620
MIRT537453	hsa-miR-106a-5p	PAR-CLIP	22012620
MIRT537452	hsa-miR-106b-5p	PAR-CLIP	22012620
MIRT537451	hsa-miR-17-5p	PAR-CLIP	22012620
MIRT537450	hsa-miR-20a-5p	PAR-CLIP	22012620
MIRT537449	hsa-miR-20b-5p	PAR-CLIP	22012620
MIRT537448	hsa-miR-519d-3p	PAR-CLIP	22012620
MIRT537447	hsa-miR-526b-3p	PAR-CLIP	22012620
MIRT537446	hsa-miR-93-5p	PAR-CLIP	22012620
MIRT537445	hsa-miR-302a-3p	PAR-CLIP	22012620
MIRT537444	hsa-miR-302b-3p	PAR-CLIP	22012620
MIRT537443	hsa-miR-302c-3p	PAR-CLIP	22012620
MIRT537442	hsa-miR-302d-3p	PAR-CLIP	22012620
MIRT537441	hsa-miR-302e	PAR-CLIP	22012620
MIRT537440	hsa-miR-372-3p	PAR-CLIP	22012620
MIRT537439	hsa-miR-373-3p	PAR-CLIP	22012620
MIRT537438	hsa-miR-520a-3p	PAR-CLIP	22012620
MIRT537437	hsa-miR-520b	PAR-CLIP	22012620
MIRT537436	hsa-miR-520c-3p	PAR-CLIP	22012620
MIRT537435	hsa-miR-520d-3p	PAR-CLIP	22012620
MIRT537434	hsa-miR-520e	PAR-CLIP	22012620
MIRT537433	hsa-miR-5579-5p	PAR-CLIP	22012620
MIRT537432	hsa-miR-4461	PAR-CLIP	22012620
MIRT537431	hsa-miR-520g-3p	PAR-CLIP	22012620
MIRT537430	hsa-miR-520h	PAR-CLIP	22012620
MIRT537429	hsa-miR-219a-1-3p	PAR-CLIP	22012620
MIRT537428	hsa-miR-571	PAR-CLIP	22012620
MIRT537427	hsa-miR-31-3p	PAR-CLIP	22012620
MIRT537426	hsa-miR-5681b	PAR-CLIP	22012620
MIRT537425	hsa-miR-518a-5p	PAR-CLIP	22012620
MIRT537424	hsa-miR-527	PAR-CLIP	22012620
MIRT537423	hsa-miR-3912-5p	PAR-CLIP	22012620
MIRT991167	hsa-miR-1184	CLIP-seq
MIRT991168	hsa-miR-1193	CLIP-seq
MIRT991169	hsa-miR-1285	CLIP-seq
MIRT991170	hsa-miR-1287	CLIP-seq
MIRT991171	hsa-miR-132	CLIP-seq
MIRT991172	hsa-miR-1343	CLIP-seq
MIRT991173	hsa-miR-141	CLIP-seq
MIRT991174	hsa-miR-148a	CLIP-seq
MIRT991175	hsa-miR-148b	CLIP-seq
MIRT991176	hsa-miR-152	CLIP-seq
MIRT991177	hsa-miR-200a	CLIP-seq
MIRT991178	hsa-miR-212	CLIP-seq
MIRT991179	hsa-miR-3135b	CLIP-seq
MIRT991180	hsa-miR-3160-3p	CLIP-seq
MIRT991181	hsa-miR-3187-5p	CLIP-seq
MIRT991182	hsa-miR-3689a-3p	CLIP-seq
MIRT991183	hsa-miR-3689c	CLIP-seq
MIRT991184	hsa-miR-3915	CLIP-seq
MIRT991185	hsa-miR-3928	CLIP-seq
MIRT991186	hsa-miR-4276	CLIP-seq
MIRT991187	hsa-miR-4297	CLIP-seq
MIRT991188	hsa-miR-4302	CLIP-seq
MIRT991189	hsa-miR-4455	CLIP-seq
MIRT991190	hsa-miR-4648	CLIP-seq
MIRT991191	hsa-miR-4654	CLIP-seq
MIRT991192	hsa-miR-4690-3p	CLIP-seq
MIRT991193	hsa-miR-4718	CLIP-seq
MIRT991194	hsa-miR-4728-5p	CLIP-seq
MIRT991195	hsa-miR-4731-5p	CLIP-seq
MIRT991196	hsa-miR-4769-5p	CLIP-seq
MIRT991197	hsa-miR-488	CLIP-seq
MIRT991198	hsa-miR-509-3p	CLIP-seq
MIRT991199	hsa-miR-512-3p	CLIP-seq
MIRT991200	hsa-miR-570	CLIP-seq
MIRT991201	hsa-miR-609	CLIP-seq
MIRT991202	hsa-miR-612	CLIP-seq
MIRT991203	hsa-miR-671-5p	CLIP-seq
MIRT991204	hsa-miR-7	CLIP-seq
MIRT991167	hsa-miR-1184	CLIP-seq
MIRT1993913	hsa-miR-1253	CLIP-seq
MIRT1993914	hsa-miR-1976	CLIP-seq
MIRT1993915	hsa-miR-2355-5p	CLIP-seq
MIRT1993916	hsa-miR-3151	CLIP-seq
MIRT1993917	hsa-miR-3165	CLIP-seq
MIRT991192	hsa-miR-4690-3p	CLIP-seq
MIRT991204	hsa-miR-7	CLIP-seq
MIRT1993918	hsa-miR-9	CLIP-seq
MIRT2227955	hsa-miR-1182	CLIP-seq
MIRT991167	hsa-miR-1184	CLIP-seq
MIRT991170	hsa-miR-1287	CLIP-seq
MIRT991174	hsa-miR-148a	CLIP-seq
MIRT991175	hsa-miR-148b	CLIP-seq
MIRT991176	hsa-miR-152	CLIP-seq
MIRT1993914	hsa-miR-1976	CLIP-seq
MIRT1993915	hsa-miR-2355-5p	CLIP-seq
MIRT991179	hsa-miR-3135b	CLIP-seq
MIRT2227956	hsa-miR-3140-5p	CLIP-seq
MIRT991186	hsa-miR-4276	CLIP-seq
MIRT991192	hsa-miR-4690-3p	CLIP-seq
MIRT991199	hsa-miR-512-3p	CLIP-seq
MIRT991203	hsa-miR-671-5p	CLIP-seq
MIRT991167	hsa-miR-1184	CLIP-seq
MIRT991170	hsa-miR-1287	CLIP-seq
MIRT991174	hsa-miR-148a	CLIP-seq
MIRT991175	hsa-miR-148b	CLIP-seq
MIRT991176	hsa-miR-152	CLIP-seq
MIRT991179	hsa-miR-3135b	CLIP-seq
MIRT991186	hsa-miR-4276	CLIP-seq
MIRT991192	hsa-miR-4690-3p	CLIP-seq
MIRT991199	hsa-miR-512-3p	CLIP-seq
MIRT991203	hsa-miR-671-5p	CLIP-seq
MIRT2428846	hsa-miR-1915	CLIP-seq
MIRT2428847	hsa-miR-3159	CLIP-seq
MIRT2428848	hsa-miR-3162-5p	CLIP-seq
MIRT2428849	hsa-miR-3667-5p	CLIP-seq
MIRT2428850	hsa-miR-3918	CLIP-seq
MIRT2428851	hsa-miR-4685-5p	CLIP-seq
MIRT991167	hsa-miR-1184	CLIP-seq
MIRT991170	hsa-miR-1287	CLIP-seq
MIRT991174	hsa-miR-148a	CLIP-seq
MIRT991175	hsa-miR-148b	CLIP-seq
MIRT991176	hsa-miR-152	CLIP-seq
MIRT991179	hsa-miR-3135b	CLIP-seq
MIRT991186	hsa-miR-4276	CLIP-seq
MIRT991192	hsa-miR-4690-3p	CLIP-seq
MIRT991199	hsa-miR-512-3p	CLIP-seq
MIRT991203	hsa-miR-671-5p	CLIP-seq
MIRT2449504	hsa-miR-19a	CLIP-seq
MIRT2449505	hsa-miR-19b	CLIP-seq
MIRT2449506	hsa-miR-3934	CLIP-seq
MIRT2449507	hsa-miR-4708-3p	CLIP-seq
MIRT2449508	hsa-miR-4755-3p	CLIP-seq
MIRT2449504	hsa-miR-19a	CLIP-seq
MIRT2449505	hsa-miR-19b	CLIP-seq
MIRT2449506	hsa-miR-3934	CLIP-seq
MIRT2449507	hsa-miR-4708-3p	CLIP-seq
MIRT2449508	hsa-miR-4755-3p	CLIP-seq
MIRT2227955	hsa-miR-1182	CLIP-seq
MIRT2531467	hsa-miR-224	CLIP-seq
MIRT2531468	hsa-miR-3134	CLIP-seq
MIRT2227956	hsa-miR-3140-5p	CLIP-seq
MIRT991180	hsa-miR-3160-3p	CLIP-seq
MIRT2531469	hsa-miR-3671	CLIP-seq
MIRT2531470	hsa-miR-3682-3p	CLIP-seq
MIRT2531471	hsa-miR-4457	CLIP-seq
MIRT2531472	hsa-miR-4502	CLIP-seq
MIRT2531473	hsa-miR-4534	CLIP-seq
MIRT2531474	hsa-miR-4679	CLIP-seq
MIRT2531475	hsa-miR-4738-3p	CLIP-seq
MIRT2531476	hsa-miR-4762-3p	CLIP-seq
MIRT2531477	hsa-miR-513b	CLIP-seq
MIRT2531478	hsa-miR-607	CLIP-seq
MIRT2227955	hsa-miR-1182	CLIP-seq
MIRT2680857	hsa-miR-133a	CLIP-seq
MIRT2680858	hsa-miR-133b	CLIP-seq
MIRT2531467	hsa-miR-224	CLIP-seq
MIRT1993915	hsa-miR-2355-5p	CLIP-seq
MIRT2531468	hsa-miR-3134	CLIP-seq
MIRT2227956	hsa-miR-3140-5p	CLIP-seq
MIRT991180	hsa-miR-3160-3p	CLIP-seq
MIRT2531469	hsa-miR-3671	CLIP-seq
MIRT2680859	hsa-miR-3679-3p	CLIP-seq
MIRT2531470	hsa-miR-3682-3p	CLIP-seq
MIRT991184	hsa-miR-3915	CLIP-seq
MIRT991185	hsa-miR-3928	CLIP-seq
MIRT2531471	hsa-miR-4457	CLIP-seq
MIRT2680860	hsa-miR-4487	CLIP-seq
MIRT2531472	hsa-miR-4502	CLIP-seq
MIRT2531473	hsa-miR-4534	CLIP-seq
MIRT2680861	hsa-miR-4663	CLIP-seq
MIRT2531474	hsa-miR-4679	CLIP-seq
MIRT2680862	hsa-miR-4686	CLIP-seq
MIRT2531475	hsa-miR-4738-3p	CLIP-seq
MIRT2531476	hsa-miR-4762-3p	CLIP-seq
MIRT2680863	hsa-miR-4786-5p	CLIP-seq
MIRT2531477	hsa-miR-513b	CLIP-seq
MIRT2680864	hsa-miR-515-5p	CLIP-seq
MIRT2680865	hsa-miR-548c-3p	CLIP-seq
MIRT2680866	hsa-miR-558	CLIP-seq
MIRT2531478	hsa-miR-607	CLIP-seq
MIRT2680867	hsa-miR-659	CLIP-seq
MIRT2680868	hsa-miR-769-5p	CLIP-seq
MIRT1993918	hsa-miR-9	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000086	Process	G2/M transition of mitotic cell cycle	IEA
GO:0000086	Process	G2/M transition of mitotic cell cycle	ISS
GO:0000151	Component	Ubiquitin ligase complex	NAS	10531035
GO:0000209	Process	Protein polyubiquitination	IDA	25778398
GO:0000209	Process	Protein polyubiquitination	IEA
GO:0000209	Process	Protein polyubiquitination	IMP	28218735
GO:0000278	Process	Mitotic cell cycle	IEA
GO:0000278	Process	Mitotic cell cycle	ISS
GO:0005515	Function	Protein binding	IPI	25778398, 28218735, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IEA
GO:0005813	Component	Centrosome	ISS
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	NAS	10531035
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016567	Process	Protein ubiquitination	ISS
GO:0019005	Component	SCF ubiquitin ligase complex	IBA
GO:0019005	Component	SCF ubiquitin ligase complex	IDA	25778398
GO:0019005	Component	SCF ubiquitin ligase complex	IEA
GO:0019005	Component	SCF ubiquitin ligase complex	ISS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IBA
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IDA	25778398
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IEA
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IMP	28218735
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	ISS
GO:0051301	Process	Cell division	IEA

MIM	HGNC	e!Ensembl
605656	13604	ENSG00000183580

Q9UJT9

Protein name

F-box/LRR-repeat protein 7 (F-box and leucine-rich repeat protein 7) (F-box protein FBL6/FBL7)

Protein function

Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex (PubMed:25778398). During mitosis, it mediates the ubiquitination and subsequent proteasomal degradation of AURKA, causing mitotic arrest (By

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00646	F-box	112 → 159	F-box domain	Domain
PF13516	LRR_6	296 → 320	Leucine Rich repeat	Repeat
PF13516	LRR_6	400 → 424	Leucine Rich repeat	Repeat
PF13516	LRR_6	426 → 447	Leucine Rich repeat	Repeat

Sequence

MGANNGKQYGSEGKGSSSISSDVSSSTDHTPTKAQKNVATSEDSDLSMRTLSTPSPALIC
PPNLPGFQNGRGSSTSSSSITGETVAMVHSPPPTRLTHPLIRLASRPQKEQASIDRLPDH
SMVQIFSFLPTNQLCRCARVCRRWYNLAWDPRLWRTIRLTGETINVDRALKVLTRRLCQD
TPNVCLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNL
EHLDVSGCSKVTCISLTREASIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIAAHCTQL
THLYLRRCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLREIAKLESRLRYLSIAHC
GRVTDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIGKCPLVSDTGL
ECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCEVSVEALRFVKRHCKR
CVIEHTNPAFF

Sequence length

491

Interactions

View interactions

	Reactome
			FBXL7 down-regulates AURKA during mitotic entry and in early mitosis Neddylation Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (13)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIGEORGE SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHOID	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (18)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28377053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	26339675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	GWASCAT_DG	24486069, 25918132		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	24486069, 31095684, 32119686	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	31095684		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	22759382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20418484	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	GWASCAT_DG	26634245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	28736931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	35887149	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioma capillary infantile	Capillary infantile hemangioma	Pubtator	36181115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	22759382	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	37179372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	23628382	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22759382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28218735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35887149	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28218735		★★★★★ ★☆☆☆☆ Found in Text Mining only

FBXL7 (F-box and leucine rich repeat protein 7)