Gene Gene information from NCBI Gene database.
Entrez ID 23193
Gene name Glucosidase II alpha subunit
Gene symbol GANAB
Synonyms (NCBI Gene)
G2ANGIIAGIIalphaGLUIIPKD3
Chromosome 11
Chromosome location 11q12.3
Summary This gene encodes the alpha subunit of glucosidase II and a member of the glycosyl hydrolase 31 family of proteins. The heterodimeric enzyme glucosidase II plays a role in protein folding and quality control by cleaving glucose residues from immature glyc
SNPs SNP information provided by dbSNP.
15
SNP ID Visualize variation Clinical significance Consequence
rs752158933 CT>- Pathogenic Intron variant, 5 prime UTR variant, coding sequence variant, frameshift variant
rs760625230 G>A,C Pathogenic Missense variant, stop gained, intron variant, coding sequence variant, 5 prime UTR variant
rs770519542 C>A,T Pathogenic Coding sequence variant, missense variant
rs879255641 CT>- Pathogenic Frameshift variant, coding sequence variant
rs879255642 G>C Pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
389
miRTarBase ID miRNA Experiments Reference
MIRT050974 hsa-miR-17-5p CLASH 23622248
MIRT049013 hsa-miR-92a-3p CLASH 23622248
MIRT048291 hsa-miR-107 CLASH 23622248
MIRT047360 hsa-miR-34a-5p CLASH 23622248
MIRT047329 hsa-miR-181a-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
30
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding HDA 22658674
GO:0003824 Function Catalytic activity IEA
GO:0004553 Function Hydrolase activity, hydrolyzing O-glycosyl compounds IEA
GO:0005515 Function Protein binding IPI 10929008
GO:0005783 Component Endoplasmic reticulum IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
104160 4138 ENSG00000089597
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q14697
Protein name Neutral alpha-glucosidase AB (EC 3.2.1.207) (Alpha-glucosidase 2) (Glucosidase II subunit alpha)
Protein function Catalytic subunit of glucosidase II that cleaves sequentially the 2 innermost alpha-1,3-linked glucose residues from the Glc(2)Man(9)GlcNAc(2) oligosaccharide precursor of immature glycoproteins (PubMed:10929008). Required for PKD1/Polycystin-1
PDB 8D43 , 8EMR
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13802 Gal_mutarotas_2 253 324 Galactose mutarotase-like Domain
PF01055 Glyco_hydro_31 365 810 Glycosyl hydrolases family 31 Family
Tissue specificity TISSUE SPECIFICITY: Detected in placenta (PubMed:3881423). Isoform 1 and isoform 2 are expressed in the kidney and liver (PubMed:27259053). {ECO:0000269|PubMed:27259053, ECO:0000269|PubMed:3881423}.
Sequence
MAAVAAVAARRRRSWASLVLAFLGVCLGITLAVDRSNFKTCEESSFCKRQRSIRPGLSPY
RALLDSLQLGPDSLTVHLIHEVTKVLLVLELQGLQKNMTRFRIDELEPRRPRYRVPDVLV
ADPPIARLSVSGRDENSVELTMAEGPYKIILTARPFRLDLLEDRSLLLSVNARGLLEFEH
QRAPRVSQGSKDPAEGDGAQPEETPRDGDKPEETQGKAEKDEPGAWEETFKTHSDSKPYG
PMSVGLDFSLPGMEHVYGIPEHADNLRLKVTEGGEPYRLYNLDVFQYELYNPMALYGSVP
VLLAHNPHRDLGIFWLNAAETWVD
ISSNTAGKTLFGKMMDYLQGSGETPQTDVRWMSETG
IIDVFLLLGPSISDVFRQYASLTGTQALPPLFSLGYHQSRWNYRDEADVLEVDQGFDDHN
LPCDVIWLDIEHADGKRYFTWDPSRFPQPRTMLERLASKRRKLVAIVDPHIKVDSGYRVH
EELRNLGLYVKTRDGSDYEGWCWPGSAGYPDFTNPTMRAWWANMFSYDNYEGSAPNLFVW
NDMNEPSVFNGPEVTMLKDAQHYGGWEHRDVHNIYGLYVHMATADGLRQRSGGMERPFVL
ARAFFAGSQRFGAVWTGDNTAEWDHLKISIPMCLSLGLVGLSFCGADVGGFFKNPEPELL
VRWYQMGAYQPFFRAHAHLDTGRREPWLLPSQHNDIIRDALGQRYSLLPFWYTLLYQAHR
EGIPVMRPLWVQYPQDVTTFNIDDQYLLGDALLVHPVSDSGAHGVQVYLPGQGEVWYDIQ
SYQKHHGPQTLYLPVTLSSIPVFQRGGTIV
PRWMRVRRSSECMKDDPITLFVALSPQGTA
QGELFLDDGHTFNYQTRQEFLLRRFSFSGNTLVSSSADPEGHFETPIWIERVVIIGAGKP
AAVVLQTKGSPESRLSFQHDPETSVLVLRKPGINVASDWSIHLR
Sequence length 944
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  N-Glycan biosynthesis
Metabolic pathways
Protein processing in endoplasmic reticulum
  N-glycan trimming in the ER and Calnexin/Calreticulin cycle
Calnexin/calreticulin cycle
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
22
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Autosomal dominant polycystic kidney disease Pathogenic rs750723025 RCV000758152
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Autosomal dominant polycystic liver disease Pathogenic; Likely pathogenic rs1210158408, rs1565088616, rs1565092566, rs1565092899, rs1565093675, rs1465649718, rs1565099895, rs1565116806 RCV000758157
RCV000758156
RCV000758159
RCV000758155
RCV000758158
View all (3 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Biliary tract abnormality Pathogenic; Likely pathogenic rs1210158408, rs1565088616 RCV005622017
RCV005626185
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
GANAB-related disorder Likely pathogenic; Pathogenic rs752158933, rs2496332587 RCV003920006
RCV003964499
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cervical cancer Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Chronic kidney disease Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASES Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Alzheimer Disease Alzheimer disease Pubtator 35766008 Associate
★☆☆☆☆
Found in Text Mining only
Autosomal dominant polycystic kidney disease Polycystic kidney disease Orphanet
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cardiomyopathy Restrictive Restrictive cardiomyopathy Pubtator 31037987 Associate
★☆☆☆☆
Found in Text Mining only
Degenerative polyarthritis Arthritis BEFREE 16139532
★☆☆☆☆
Found in Text Mining only
Familial paroxysmal dystonia Paroxysmal dystonia Pubtator 27259053 Associate
★☆☆☆☆
Found in Text Mining only
Isolated polycystic liver disease Polycystic liver disease BEFREE 29243290
★☆☆☆☆
Found in Text Mining only
Kidney Diseases Cystic Kidney disease Pubtator 36573973 Associate
★☆☆☆☆
Found in Text Mining only
Liver cyst Liver Cyst HPO_DG
★☆☆☆☆
Found in Text Mining only
Multiple Sclerosis Multiple Sclerosis BEFREE 19218359
★☆☆☆☆
Found in Text Mining only
Polycystic Kidney Autosomal Dominant Polycystic kidney disease Pubtator 27259053, 28522688, 30333007, 33097077, 36833371, 38537868 Associate
★☆☆☆☆
Found in Text Mining only