Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	23180
Gene name	Raftlin, lipid raft linker 1
Gene symbol	RFTN1
Synonyms (NCBI Gene)	MIG2PIB10PIG9RAFTLIN
Chromosome	3
Chromosome location	3p24.3

142

Show/Hide all (142)

miRTarBase ID	miRNA	Experiments	Reference
MIRT041930	hsa-miR-484	CLASH	23622248
MIRT1302060	hsa-miR-1179	CLIP-seq
MIRT1302061	hsa-miR-1246	CLIP-seq
MIRT1302062	hsa-miR-1253	CLIP-seq
MIRT1302063	hsa-miR-1290	CLIP-seq
MIRT1302064	hsa-miR-133a	CLIP-seq
MIRT1302065	hsa-miR-133b	CLIP-seq
MIRT1302066	hsa-miR-1915	CLIP-seq
MIRT1302067	hsa-miR-3167	CLIP-seq
MIRT1302068	hsa-miR-3674	CLIP-seq
MIRT1302069	hsa-miR-3938	CLIP-seq
MIRT1302070	hsa-miR-4310	CLIP-seq
MIRT1302071	hsa-miR-4438	CLIP-seq
MIRT1302072	hsa-miR-4648	CLIP-seq
MIRT1302073	hsa-miR-4654	CLIP-seq
MIRT1302074	hsa-miR-4769-5p	CLIP-seq
MIRT1302075	hsa-miR-490-5p	CLIP-seq
MIRT1302076	hsa-miR-515-5p	CLIP-seq
MIRT1302077	hsa-miR-629	CLIP-seq
MIRT1302078	hsa-miR-642a	CLIP-seq
MIRT1302079	hsa-miR-876-5p	CLIP-seq
MIRT2089636	hsa-miR-299-3p	CLIP-seq
MIRT1302071	hsa-miR-4438	CLIP-seq
MIRT1302072	hsa-miR-4648	CLIP-seq
MIRT1302073	hsa-miR-4654	CLIP-seq
MIRT1302074	hsa-miR-4769-5p	CLIP-seq
MIRT1302077	hsa-miR-629	CLIP-seq
MIRT2314595	hsa-miR-3591-3p	CLIP-seq
MIRT1302071	hsa-miR-4438	CLIP-seq
MIRT2314596	hsa-miR-4721	CLIP-seq
MIRT2314597	hsa-miR-4733-3p	CLIP-seq
MIRT2610901	hsa-miR-125a-3p	CLIP-seq
MIRT2610902	hsa-miR-1291	CLIP-seq
MIRT2610903	hsa-miR-141	CLIP-seq
MIRT2610904	hsa-miR-145	CLIP-seq
MIRT2610905	hsa-miR-1825	CLIP-seq
MIRT2610906	hsa-miR-199a-5p	CLIP-seq
MIRT2610907	hsa-miR-199b-5p	CLIP-seq
MIRT2610908	hsa-miR-19a	CLIP-seq
MIRT2610909	hsa-miR-19b	CLIP-seq
MIRT2610910	hsa-miR-200a	CLIP-seq
MIRT2610911	hsa-miR-2276	CLIP-seq
MIRT2610912	hsa-miR-24	CLIP-seq
MIRT2610913	hsa-miR-2467-3p	CLIP-seq
MIRT2610914	hsa-miR-3180-5p	CLIP-seq
MIRT2610915	hsa-miR-3192	CLIP-seq
MIRT2610916	hsa-miR-328	CLIP-seq
MIRT2610917	hsa-miR-3670	CLIP-seq
MIRT2610918	hsa-miR-3678-3p	CLIP-seq
MIRT2610919	hsa-miR-3681	CLIP-seq
MIRT2610920	hsa-miR-3682-5p	CLIP-seq
MIRT2610921	hsa-miR-3689a-3p	CLIP-seq
MIRT2610922	hsa-miR-3689c	CLIP-seq
MIRT2610923	hsa-miR-3691-5p	CLIP-seq
MIRT2610924	hsa-miR-3914	CLIP-seq
MIRT2610925	hsa-miR-3934	CLIP-seq
MIRT2610926	hsa-miR-4292	CLIP-seq
MIRT2610927	hsa-miR-4428	CLIP-seq
MIRT2610928	hsa-miR-4437	CLIP-seq
MIRT2610929	hsa-miR-4457	CLIP-seq
MIRT2314596	hsa-miR-4721	CLIP-seq
MIRT2610930	hsa-miR-4728-5p	CLIP-seq
MIRT2610931	hsa-miR-4764-5p	CLIP-seq
MIRT2610932	hsa-miR-4772-3p	CLIP-seq
MIRT2610933	hsa-miR-4778-3p	CLIP-seq
MIRT2610934	hsa-miR-4792	CLIP-seq
MIRT2610935	hsa-miR-490-3p	CLIP-seq
MIRT2610936	hsa-miR-502-5p	CLIP-seq
MIRT2610937	hsa-miR-513b	CLIP-seq
MIRT2610938	hsa-miR-520a-5p	CLIP-seq
MIRT2610939	hsa-miR-525-5p	CLIP-seq
MIRT2610940	hsa-miR-543	CLIP-seq
MIRT2610941	hsa-miR-544	CLIP-seq
MIRT2610942	hsa-miR-548aa	CLIP-seq
MIRT2610943	hsa-miR-548ac	CLIP-seq
MIRT2610944	hsa-miR-548d-3p	CLIP-seq
MIRT2610945	hsa-miR-548n	CLIP-seq
MIRT2610946	hsa-miR-548z	CLIP-seq
MIRT2610947	hsa-miR-579	CLIP-seq
MIRT2610948	hsa-miR-764	CLIP-seq
MIRT2610949	hsa-miR-873	CLIP-seq
MIRT2610901	hsa-miR-125a-3p	CLIP-seq
MIRT2610902	hsa-miR-1291	CLIP-seq
MIRT2610903	hsa-miR-141	CLIP-seq
MIRT2610904	hsa-miR-145	CLIP-seq
MIRT2610905	hsa-miR-1825	CLIP-seq
MIRT2610906	hsa-miR-199a-5p	CLIP-seq
MIRT2610907	hsa-miR-199b-5p	CLIP-seq
MIRT2610908	hsa-miR-19a	CLIP-seq
MIRT2610909	hsa-miR-19b	CLIP-seq
MIRT2610910	hsa-miR-200a	CLIP-seq
MIRT2610911	hsa-miR-2276	CLIP-seq
MIRT2610912	hsa-miR-24	CLIP-seq
MIRT2610913	hsa-miR-2467-3p	CLIP-seq
MIRT2689693	hsa-miR-3117-3p	CLIP-seq
MIRT2689694	hsa-miR-3169	CLIP-seq
MIRT2610914	hsa-miR-3180-5p	CLIP-seq
MIRT2610915	hsa-miR-3192	CLIP-seq
MIRT2689695	hsa-miR-320a	CLIP-seq
MIRT2689696	hsa-miR-320b	CLIP-seq
MIRT2689697	hsa-miR-320c	CLIP-seq
MIRT2689698	hsa-miR-320d	CLIP-seq
MIRT2689699	hsa-miR-320e	CLIP-seq
MIRT2610916	hsa-miR-328	CLIP-seq
MIRT2610917	hsa-miR-3670	CLIP-seq
MIRT2610918	hsa-miR-3678-3p	CLIP-seq
MIRT2610919	hsa-miR-3681	CLIP-seq
MIRT2610920	hsa-miR-3682-5p	CLIP-seq
MIRT2610921	hsa-miR-3689a-3p	CLIP-seq
MIRT2610922	hsa-miR-3689c	CLIP-seq
MIRT2610923	hsa-miR-3691-5p	CLIP-seq
MIRT2610924	hsa-miR-3914	CLIP-seq
MIRT2610925	hsa-miR-3934	CLIP-seq
MIRT2610926	hsa-miR-4292	CLIP-seq
MIRT2610927	hsa-miR-4428	CLIP-seq
MIRT2689700	hsa-miR-4429	CLIP-seq
MIRT2610928	hsa-miR-4437	CLIP-seq
MIRT2610929	hsa-miR-4457	CLIP-seq
MIRT2314596	hsa-miR-4721	CLIP-seq
MIRT2610930	hsa-miR-4728-5p	CLIP-seq
MIRT2689701	hsa-miR-4759	CLIP-seq
MIRT2610931	hsa-miR-4764-5p	CLIP-seq
MIRT2610932	hsa-miR-4772-3p	CLIP-seq
MIRT2610933	hsa-miR-4778-3p	CLIP-seq
MIRT2610934	hsa-miR-4792	CLIP-seq
MIRT2610935	hsa-miR-490-3p	CLIP-seq
MIRT2610936	hsa-miR-502-5p	CLIP-seq
MIRT2610937	hsa-miR-513b	CLIP-seq
MIRT2610938	hsa-miR-520a-5p	CLIP-seq
MIRT2610939	hsa-miR-525-5p	CLIP-seq
MIRT2689702	hsa-miR-539	CLIP-seq
MIRT2610940	hsa-miR-543	CLIP-seq
MIRT2610941	hsa-miR-544	CLIP-seq
MIRT2610942	hsa-miR-548aa	CLIP-seq
MIRT2610943	hsa-miR-548ac	CLIP-seq
MIRT2610944	hsa-miR-548d-3p	CLIP-seq
MIRT2610945	hsa-miR-548n	CLIP-seq
MIRT2610946	hsa-miR-548z	CLIP-seq
MIRT2610947	hsa-miR-579	CLIP-seq
MIRT2689703	hsa-miR-580	CLIP-seq
MIRT2610948	hsa-miR-764	CLIP-seq
MIRT2610949	hsa-miR-873	CLIP-seq

Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001765	Process	Membrane raft assembly	IMP	12805216
GO:0002457	Process	T cell antigen processing and presentation	IEA
GO:0002457	Process	T cell antigen processing and presentation	ISS
GO:0003725	Function	Double-stranded RNA binding	IDA	21266579
GO:0005737	Component	Cytoplasm	IDA	21266579
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IDA	21266579
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IEA
GO:0005886	Component	Plasma membrane	IDA	12805216, 21266579
GO:0005886	Component	Plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0032596	Process	Protein transport into membrane raft	IEA
GO:0032596	Process	Protein transport into membrane raft	ISS
GO:0032740	Process	Positive regulation of interleukin-17 production	IEA
GO:0032740	Process	Positive regulation of interleukin-17 production	ISS
GO:0032991	Component	Protein-containing complex	IDA	21266579
GO:0033227	Process	DsRNA transport	IMP	21266579
GO:0034138	Process	Toll-like receptor 3 signaling pathway	IMP	21266579
GO:0040010	Process	Positive regulation of growth rate	IMP	12805216
GO:0043330	Process	Response to exogenous dsRNA	IMP	21266579
GO:0045121	Component	Membrane raft	IDA	12805216, 21955986
GO:0045121	Component	Membrane raft	IEA
GO:0050852	Process	T cell receptor signaling pathway	IEA
GO:0050852	Process	T cell receptor signaling pathway	ISS
GO:0050853	Process	B cell receptor signaling pathway	IMP	12805216
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:1903044	Process	Protein localization to membrane raft	IEA
GO:1903044	Process	Protein localization to membrane raft	ISS

MIM	HGNC	e!Ensembl
618210	30278	ENSG00000131378

Q14699

Protein name

Raftlin (Cell migration-inducing gene 2 protein) (Raft-linking protein)

Protein function

Involved in protein trafficking via association with clathrin and AP2 complex (PubMed:21266579, PubMed:27022195). Upon bacterial lipopolysaccharide stimulation, mediates internalization of TLR4 to endosomes in dendritic cells and macrophages; an

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15250	Raftlin	1 → 471	Raftlin	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in B-cells (at protein level) (PubMed:12805216). Expressed in dendritic cells and macrophages (PubMed:21266579, PubMed:27022195). {ECO:0000269|PubMed:12805216, ECO:0000269|PubMed:21266579, ECO:0000269|PubMed:27022195}.

Sequence

MGCGLNKLEKRDEKRPGNIYSTLKRPQVETKIDVSYEYRFLEFTTLSAAELPGSSAVRLA
SLRDLPAQLLELYQQGFSLAALHPFVQPTHEREKTPLEHIFRAILIKKTDRSQKTDLHNE
GYILELDCCSSLDHPTDQKLIPEFIKKIQEAASQGLKFVGVIPQYHSSVNSAGSSAPVST
ANSTEDARDAKNARGDHASLENEKPGTGDVCSAPAGRNQSPEPSSGPRGEVPLAKQPSSP
SGEGDGGELSPQGVSKTLDGPESNPLEVHEEPLSGKMEIFTLFNKPKSHQKCRQYYPVTI
PLHVSKNGQTVSGLDANWLEHMSDHFRKGGMLVNAVFYLGIVNDSLHGLTDGVFIFEAVS
TEDSKTIQGYDAIVVEQWTVLEGVEVQTDYVPLLNSLAAYGWQLTCVLPTPVVKTTSEGS
VSTKQIVFLQRPCLPQKIKKKESKFQWRFSREEMHNRQMRKSKGKLSARDKQQAEENEKN
LEDQSSKAGDMGNCVSGQQQEGGVSEEMKGPVQEDKGEQLSPGGLLCGVGVEGEAVQNGP
ASHSRALVGICTGHSNPGEDARDGDAEEVRELGTVEEN

Sequence length

578

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
FEMALE REPRODUCTIVE SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THORACIC AORTIC ANEURYSM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	17387528	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23645746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32544548	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	36139155	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	14745725		★★★★★ ★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	14745725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	39849531	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23645746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	36139155	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	14745725		★★★★★ ★☆☆☆☆ Found in Text Mining only

RFTN1 (raftlin, lipid raft linker 1)