Gene Gene information from NCBI Gene database.
Entrez ID 23163
Gene name Golgi associated, gamma adaptin ear containing, ARF binding protein 3
Gene symbol GGA3
Synonyms (NCBI Gene)
-
Chromosome 17
Chromosome location 17q25.1
Summary This gene encodes a member of the Golgi-localized, gamma adaptin ear-containing, ARF-binding (GGA) family. This family includes ubiquitous coat proteins that regulate the trafficking of proteins between the trans-Golgi network and the lysosome. These prot
miRNA miRNA information provided by mirtarbase database.
590
miRTarBase ID miRNA Experiments Reference
MIRT026056 hsa-miR-196a-5p Sequencing 20371350
MIRT027133 hsa-miR-103a-3p Sequencing 20371350
MIRT029653 hsa-miR-26b-5p Sequencing 20371350
MIRT050447 hsa-miR-23a-3p CLASH 23622248
MIRT040417 hsa-miR-615-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
45
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 11387475, 12505986, 14638859, 15039775, 16977309, 17116753, 23143332, 24056087, 26053850, 26446845, 26811329, 32296183, 32334026, 37100772
GO:0005764 Component Lysosome IDA 17116753
GO:0005768 Component Endosome IEA
GO:0005769 Component Early endosome IEA
GO:0005794 Component Golgi apparatus IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606006 17079 ENSG00000125447
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NZ52
Protein name ADP-ribosylation factor-binding protein GGA3 (Golgi-localized, gamma ear-containing, ARF-binding protein 3)
Protein function Plays a role in protein sorting and trafficking between the trans-Golgi network (TGN) and endosomes. Mediates the ARF-dependent recruitment of clathrin to the TGN and binds ubiquitinated proteins and membrane cargo molecules with a cytosolic aci
PDB 1JPL , 1JUQ , 1LF8 , 1P4U , 1WR6 , 1YD8
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00790 VHS 3 142 VHS domain Domain
PF18308 GGA_N-GAT 169 207 GGA N-GAT domain Domain
PF03127 GAT 222 299 GAT domain Domain
PF02883 Alpha_adaptinC2 597 715 Adaptin C-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed.
Sequence
MAEAEGESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKIQSPQEW
EALQALTVLEACMKNCGRRFHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTKVIELLYS
WTMALPEEAKIKDAYHMLKRQG
IVQSDPPIPVDRTLIPSPPPRPKNPVFDDEEKSKLLAK
LLKSKNPDDLQEANKLIKSMVKEDEAR
IQKVTKRLHTLEEVNNNVRLLSEMLLHYSQEDS
SDGDRELMKELFDQCENKRRTLFKLASETEDNDNSLGDILQASDNLSRVINSYKTIIEG
Q
VINGEVATLTLPDSEGNSQCSNQGTLIDLAELDTTNSLSSVLAPAPTPPSSGIPILPPPP
QASGPPRSRSSSQAEATLGPSSTSNALSWLDEELLCLGLADPAPNVPPKESAGNSQWHLL
QREQSDLDFFSPRPGTAACGASDAPLLQPSAPSSSSSQAPLPPPFPAPVVPASVPAPSAG
SSLFSTGVAPALAPKVEPAVPGHHGLALGNSALHHLDALDQLLEEAKVTSGLVKPTTSPL
IPTTTPARPLLPFSTGPGSPLFQPLSFQSQGSPPKGPELSLASIHVPLESIKPSSALPVT
AYDKNGFRILFHFAKECPPGRPDVLVVVVSMLNTAPLPVKSIVLQAAVPKSMKVKLQPPS
GTELSPFSPIQPPAAITQVMLLANPLKEKVRLRYKLTFALGEQLSTEVGEVDQFP
PVEQW
GNL
Sequence length 723
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Lysosome   TBC/RABGAPs
MET receptor recycling
Amyloid fiber formation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
NEPHROTIC SYNDROME, TYPE 17 Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Brain Ischemia Cerebral Ischemia LHGDN 17553422
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 26474971 Inhibit
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus Type 2 Diabetes mellitus, type 2 Pubtator 29273463, 31402603 Associate
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent Diabetes Mellitus BEFREE 29273463, 31402603
★☆☆☆☆
Found in Text Mining only
Dyslipidemias Dyslipidemias BEFREE 31402603
★☆☆☆☆
Found in Text Mining only
Dyslipidemias Dyslipidemias Pubtator 31402603 Associate
★☆☆☆☆
Found in Text Mining only
Hypertension Hypertension Pubtator 31402603 Associate
★☆☆☆☆
Found in Text Mining only
Hyperuricemia Hyperuricemia Pubtator 31402603 Associate
★☆☆☆☆
Found in Text Mining only
Liver carcinoma Liver carcinoma BEFREE 24044647, 28587113
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of breast Breast Cancer UNIPROT_DG
★☆☆☆☆
Found in Text Mining only