Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	23158
Gene name	TBC1 domain family member 9
Gene symbol	TBC1D9
Synonyms (NCBI Gene)	GRAMD9MDR1
Chromosome	4
Chromosome location	4q31.21

434

Show/Hide all (434)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020468	hsa-miR-106b-5p	Microarray	17242205
MIRT021451	hsa-miR-9-5p	Microarray	17612493
MIRT021857	hsa-miR-132-3p	Microarray	17612493
MIRT024035	hsa-miR-1-3p	Microarray	18668037
MIRT024119	hsa-let-7g-5p	qRT-PCR;Other	21618519
MIRT046204	hsa-miR-27b-3p	CLASH	23622248
MIRT1413741	hsa-miR-1	CLIP-seq
MIRT1413742	hsa-miR-106a	CLIP-seq
MIRT1413743	hsa-miR-106b	CLIP-seq
MIRT1413744	hsa-miR-1197	CLIP-seq
MIRT1413745	hsa-miR-129-5p	CLIP-seq
MIRT1413746	hsa-miR-1304	CLIP-seq
MIRT1413747	hsa-miR-132	CLIP-seq
MIRT1413748	hsa-miR-141	CLIP-seq
MIRT1413749	hsa-miR-142-5p	CLIP-seq
MIRT1413750	hsa-miR-15a	CLIP-seq
MIRT1413751	hsa-miR-15b	CLIP-seq
MIRT1413752	hsa-miR-16	CLIP-seq
MIRT1413753	hsa-miR-17	CLIP-seq
MIRT1413754	hsa-miR-181a	CLIP-seq
MIRT1413755	hsa-miR-181b	CLIP-seq
MIRT1413756	hsa-miR-181c	CLIP-seq
MIRT1413757	hsa-miR-181d	CLIP-seq
MIRT1413758	hsa-miR-190	CLIP-seq
MIRT1413759	hsa-miR-190b	CLIP-seq
MIRT1413760	hsa-miR-195	CLIP-seq
MIRT1413761	hsa-miR-200a	CLIP-seq
MIRT1413762	hsa-miR-206	CLIP-seq
MIRT1413763	hsa-miR-20a	CLIP-seq
MIRT1413764	hsa-miR-20b	CLIP-seq
MIRT1413765	hsa-miR-212	CLIP-seq
MIRT1413766	hsa-miR-2278	CLIP-seq
MIRT1413767	hsa-miR-23a	CLIP-seq
MIRT1413768	hsa-miR-23b	CLIP-seq
MIRT1413769	hsa-miR-23c	CLIP-seq
MIRT1413770	hsa-miR-299-3p	CLIP-seq
MIRT1413771	hsa-miR-3065-5p	CLIP-seq
MIRT1413772	hsa-miR-3119	CLIP-seq
MIRT1413773	hsa-miR-3120-3p	CLIP-seq
MIRT1413774	hsa-miR-3121-3p	CLIP-seq
MIRT1413775	hsa-miR-3134	CLIP-seq
MIRT1413776	hsa-miR-3136-5p	CLIP-seq
MIRT1413777	hsa-miR-3163	CLIP-seq
MIRT1413778	hsa-miR-323-3p	CLIP-seq
MIRT1413779	hsa-miR-329	CLIP-seq
MIRT1413780	hsa-miR-33a	CLIP-seq
MIRT1413781	hsa-miR-33b	CLIP-seq
MIRT1413782	hsa-miR-340	CLIP-seq
MIRT1413783	hsa-miR-34c-3p	CLIP-seq
MIRT1413784	hsa-miR-3607-3p	CLIP-seq
MIRT1413785	hsa-miR-3609	CLIP-seq
MIRT1413786	hsa-miR-361-5p	CLIP-seq
MIRT1413787	hsa-miR-362-3p	CLIP-seq
MIRT1413788	hsa-miR-3653	CLIP-seq
MIRT1413789	hsa-miR-3660	CLIP-seq
MIRT1413790	hsa-miR-3665	CLIP-seq
MIRT1413791	hsa-miR-3675-3p	CLIP-seq
MIRT1413792	hsa-miR-3678-3p	CLIP-seq
MIRT1413793	hsa-miR-3686	CLIP-seq
MIRT1413794	hsa-miR-3688-3p	CLIP-seq
MIRT1413795	hsa-miR-3692	CLIP-seq
MIRT1413796	hsa-miR-369-3p	CLIP-seq
MIRT1413797	hsa-miR-374a	CLIP-seq
MIRT1413798	hsa-miR-374b	CLIP-seq
MIRT1413799	hsa-miR-374c	CLIP-seq
MIRT1413800	hsa-miR-375	CLIP-seq
MIRT1413801	hsa-miR-3941	CLIP-seq
MIRT1413802	hsa-miR-3942-5p	CLIP-seq
MIRT1413803	hsa-miR-3973	CLIP-seq
MIRT1413804	hsa-miR-3978	CLIP-seq
MIRT1413805	hsa-miR-410	CLIP-seq
MIRT1413806	hsa-miR-421	CLIP-seq
MIRT1413807	hsa-miR-424	CLIP-seq
MIRT1413808	hsa-miR-4262	CLIP-seq
MIRT1413809	hsa-miR-4272	CLIP-seq
MIRT1413810	hsa-miR-4307	CLIP-seq
MIRT1413811	hsa-miR-4328	CLIP-seq
MIRT1413812	hsa-miR-4420	CLIP-seq
MIRT1413813	hsa-miR-4426	CLIP-seq
MIRT1413814	hsa-miR-4439	CLIP-seq
MIRT1413815	hsa-miR-4452	CLIP-seq
MIRT1413816	hsa-miR-4474-3p	CLIP-seq
MIRT1413817	hsa-miR-4490	CLIP-seq
MIRT1413818	hsa-miR-4491	CLIP-seq
MIRT1413819	hsa-miR-4504	CLIP-seq
MIRT1413820	hsa-miR-450b-5p	CLIP-seq
MIRT1413821	hsa-miR-451b	CLIP-seq
MIRT1413822	hsa-miR-452	CLIP-seq
MIRT1413823	hsa-miR-4526	CLIP-seq
MIRT1413824	hsa-miR-4534	CLIP-seq
MIRT1413825	hsa-miR-4536	CLIP-seq
MIRT1413826	hsa-miR-4645-3p	CLIP-seq
MIRT1413827	hsa-miR-4647	CLIP-seq
MIRT1413828	hsa-miR-4652-3p	CLIP-seq
MIRT1413829	hsa-miR-4657	CLIP-seq
MIRT1413830	hsa-miR-4659a-3p	CLIP-seq
MIRT1413831	hsa-miR-4659b-3p	CLIP-seq
MIRT1413832	hsa-miR-4662b	CLIP-seq
MIRT1413833	hsa-miR-4676-3p	CLIP-seq
MIRT1413834	hsa-miR-4684-5p	CLIP-seq
MIRT1413835	hsa-miR-4703-5p	CLIP-seq
MIRT1413836	hsa-miR-4704-5p	CLIP-seq
MIRT1413837	hsa-miR-4709-5p	CLIP-seq
MIRT1413838	hsa-miR-4712-5p	CLIP-seq
MIRT1413839	hsa-miR-4718	CLIP-seq
MIRT1413840	hsa-miR-4742-3p	CLIP-seq
MIRT1413841	hsa-miR-4774-5p	CLIP-seq
MIRT1413842	hsa-miR-4778-5p	CLIP-seq
MIRT1413843	hsa-miR-4786-5p	CLIP-seq
MIRT1413844	hsa-miR-4789-3p	CLIP-seq
MIRT1413845	hsa-miR-4793-5p	CLIP-seq
MIRT1413846	hsa-miR-4796-3p	CLIP-seq
MIRT1413847	hsa-miR-486-5p	CLIP-seq
MIRT1413848	hsa-miR-488	CLIP-seq
MIRT1413849	hsa-miR-496	CLIP-seq
MIRT1413850	hsa-miR-497	CLIP-seq
MIRT1413851	hsa-miR-498	CLIP-seq
MIRT1413852	hsa-miR-507	CLIP-seq
MIRT1413853	hsa-miR-513a-3p	CLIP-seq
MIRT1413854	hsa-miR-514	CLIP-seq
MIRT1413855	hsa-miR-514b-3p	CLIP-seq
MIRT1413856	hsa-miR-515-5p	CLIP-seq
MIRT1413857	hsa-miR-519a	CLIP-seq
MIRT1413858	hsa-miR-519b-3p	CLIP-seq
MIRT1413859	hsa-miR-519c-3p	CLIP-seq
MIRT1413860	hsa-miR-519d	CLIP-seq
MIRT1413861	hsa-miR-520g	CLIP-seq
MIRT1413862	hsa-miR-520h	CLIP-seq
MIRT1413863	hsa-miR-522	CLIP-seq
MIRT1413864	hsa-miR-543	CLIP-seq
MIRT1413865	hsa-miR-548ah	CLIP-seq
MIRT1413866	hsa-miR-548c-3p	CLIP-seq
MIRT1413867	hsa-miR-548p	CLIP-seq
MIRT1413868	hsa-miR-557	CLIP-seq
MIRT1413869	hsa-miR-561	CLIP-seq
MIRT1413870	hsa-miR-568	CLIP-seq
MIRT1413871	hsa-miR-570	CLIP-seq
MIRT1413872	hsa-miR-579	CLIP-seq
MIRT1413873	hsa-miR-591	CLIP-seq
MIRT1413874	hsa-miR-600	CLIP-seq
MIRT1413875	hsa-miR-603	CLIP-seq
MIRT1413876	hsa-miR-605	CLIP-seq
MIRT1413877	hsa-miR-613	CLIP-seq
MIRT1413878	hsa-miR-645	CLIP-seq
MIRT1413879	hsa-miR-653	CLIP-seq
MIRT1413880	hsa-miR-655	CLIP-seq
MIRT1413881	hsa-miR-657	CLIP-seq
MIRT1413882	hsa-miR-764	CLIP-seq
MIRT1413883	hsa-miR-769-5p	CLIP-seq
MIRT1413884	hsa-miR-770-5p	CLIP-seq
MIRT1413885	hsa-miR-873	CLIP-seq
MIRT1413886	hsa-miR-93	CLIP-seq
MIRT1413887	hsa-miR-935	CLIP-seq
MIRT1413888	hsa-miR-943	CLIP-seq
MIRT2124155	hsa-miR-101	CLIP-seq
MIRT1413742	hsa-miR-106a	CLIP-seq
MIRT1413743	hsa-miR-106b	CLIP-seq
MIRT2124156	hsa-miR-1299	CLIP-seq
MIRT1413746	hsa-miR-1304	CLIP-seq
MIRT1413747	hsa-miR-132	CLIP-seq
MIRT1413748	hsa-miR-141	CLIP-seq
MIRT1413749	hsa-miR-142-5p	CLIP-seq
MIRT1413753	hsa-miR-17	CLIP-seq
MIRT1413758	hsa-miR-190	CLIP-seq
MIRT1413759	hsa-miR-190b	CLIP-seq
MIRT1413761	hsa-miR-200a	CLIP-seq
MIRT1413763	hsa-miR-20a	CLIP-seq
MIRT1413764	hsa-miR-20b	CLIP-seq
MIRT1413765	hsa-miR-212	CLIP-seq
MIRT1413766	hsa-miR-2278	CLIP-seq
MIRT1413767	hsa-miR-23a	CLIP-seq
MIRT1413768	hsa-miR-23b	CLIP-seq
MIRT1413769	hsa-miR-23c	CLIP-seq
MIRT1413770	hsa-miR-299-3p	CLIP-seq
MIRT2124157	hsa-miR-300	CLIP-seq
MIRT1413772	hsa-miR-3119	CLIP-seq
MIRT1413773	hsa-miR-3120-3p	CLIP-seq
MIRT2124158	hsa-miR-3120-5p	CLIP-seq
MIRT1413774	hsa-miR-3121-3p	CLIP-seq
MIRT1413775	hsa-miR-3134	CLIP-seq
MIRT1413776	hsa-miR-3136-5p	CLIP-seq
MIRT2124159	hsa-miR-3140-5p	CLIP-seq
MIRT1413778	hsa-miR-323-3p	CLIP-seq
MIRT1413779	hsa-miR-329	CLIP-seq
MIRT1413780	hsa-miR-33a	CLIP-seq
MIRT1413781	hsa-miR-33b	CLIP-seq
MIRT1413782	hsa-miR-340	CLIP-seq
MIRT2124160	hsa-miR-34b	CLIP-seq
MIRT1413783	hsa-miR-34c-3p	CLIP-seq
MIRT1413784	hsa-miR-3607-3p	CLIP-seq
MIRT1413785	hsa-miR-3609	CLIP-seq
MIRT1413786	hsa-miR-361-5p	CLIP-seq
MIRT1413787	hsa-miR-362-3p	CLIP-seq
MIRT1413788	hsa-miR-3653	CLIP-seq
MIRT2124161	hsa-miR-3658	CLIP-seq
MIRT1413789	hsa-miR-3660	CLIP-seq
MIRT1413790	hsa-miR-3665	CLIP-seq
MIRT1413791	hsa-miR-3675-3p	CLIP-seq
MIRT1413792	hsa-miR-3678-3p	CLIP-seq
MIRT1413793	hsa-miR-3686	CLIP-seq
MIRT1413794	hsa-miR-3688-3p	CLIP-seq
MIRT1413795	hsa-miR-3692	CLIP-seq
MIRT1413796	hsa-miR-369-3p	CLIP-seq
MIRT1413797	hsa-miR-374a	CLIP-seq
MIRT1413798	hsa-miR-374b	CLIP-seq
MIRT1413799	hsa-miR-374c	CLIP-seq
MIRT1413800	hsa-miR-375	CLIP-seq
MIRT2124162	hsa-miR-381	CLIP-seq
MIRT1413801	hsa-miR-3941	CLIP-seq
MIRT1413803	hsa-miR-3973	CLIP-seq
MIRT1413804	hsa-miR-3978	CLIP-seq
MIRT1413805	hsa-miR-410	CLIP-seq
MIRT1413806	hsa-miR-421	CLIP-seq
MIRT2124163	hsa-miR-4293	CLIP-seq
MIRT2124164	hsa-miR-4297	CLIP-seq
MIRT2124165	hsa-miR-431	CLIP-seq
MIRT1413811	hsa-miR-4328	CLIP-seq
MIRT1413812	hsa-miR-4420	CLIP-seq
MIRT1413813	hsa-miR-4426	CLIP-seq
MIRT2124166	hsa-miR-4427	CLIP-seq
MIRT2124167	hsa-miR-4434	CLIP-seq
MIRT1413814	hsa-miR-4439	CLIP-seq
MIRT1413815	hsa-miR-4452	CLIP-seq
MIRT1413816	hsa-miR-4474-3p	CLIP-seq
MIRT1413818	hsa-miR-4491	CLIP-seq
MIRT1413819	hsa-miR-4504	CLIP-seq
MIRT2124168	hsa-miR-4511	CLIP-seq
MIRT2124169	hsa-miR-4516	CLIP-seq
MIRT1413821	hsa-miR-451b	CLIP-seq
MIRT1413822	hsa-miR-452	CLIP-seq
MIRT1413823	hsa-miR-4526	CLIP-seq
MIRT2124170	hsa-miR-4531	CLIP-seq
MIRT1413824	hsa-miR-4534	CLIP-seq
MIRT1413825	hsa-miR-4536	CLIP-seq
MIRT2124171	hsa-miR-4633-5p	CLIP-seq
MIRT1413827	hsa-miR-4647	CLIP-seq
MIRT1413828	hsa-miR-4652-3p	CLIP-seq
MIRT1413829	hsa-miR-4657	CLIP-seq
MIRT1413830	hsa-miR-4659a-3p	CLIP-seq
MIRT1413831	hsa-miR-4659b-3p	CLIP-seq
MIRT1413832	hsa-miR-4662b	CLIP-seq
MIRT1413833	hsa-miR-4676-3p	CLIP-seq
MIRT1413834	hsa-miR-4684-5p	CLIP-seq
MIRT1413836	hsa-miR-4704-5p	CLIP-seq
MIRT1413837	hsa-miR-4709-5p	CLIP-seq
MIRT2124172	hsa-miR-4711-5p	CLIP-seq
MIRT1413838	hsa-miR-4712-5p	CLIP-seq
MIRT1413839	hsa-miR-4718	CLIP-seq
MIRT2124173	hsa-miR-4735-5p	CLIP-seq
MIRT1413840	hsa-miR-4742-3p	CLIP-seq
MIRT2124174	hsa-miR-4773	CLIP-seq
MIRT2124175	hsa-miR-4775	CLIP-seq
MIRT1413842	hsa-miR-4778-5p	CLIP-seq
MIRT2124176	hsa-miR-4782-5p	CLIP-seq
MIRT1413844	hsa-miR-4789-3p	CLIP-seq
MIRT1413846	hsa-miR-4796-3p	CLIP-seq
MIRT2124177	hsa-miR-4799-5p	CLIP-seq
MIRT2124178	hsa-miR-4802-5p	CLIP-seq
MIRT1413849	hsa-miR-496	CLIP-seq
MIRT1413851	hsa-miR-498	CLIP-seq
MIRT1413853	hsa-miR-513a-3p	CLIP-seq
MIRT1413854	hsa-miR-514	CLIP-seq
MIRT1413855	hsa-miR-514b-3p	CLIP-seq
MIRT1413856	hsa-miR-515-5p	CLIP-seq
MIRT2124179	hsa-miR-516b	CLIP-seq
MIRT1413857	hsa-miR-519a	CLIP-seq
MIRT1413858	hsa-miR-519b-3p	CLIP-seq
MIRT1413859	hsa-miR-519c-3p	CLIP-seq
MIRT1413860	hsa-miR-519d	CLIP-seq
MIRT1413861	hsa-miR-520g	CLIP-seq
MIRT1413862	hsa-miR-520h	CLIP-seq
MIRT1413863	hsa-miR-522	CLIP-seq
MIRT2124180	hsa-miR-532-5p	CLIP-seq
MIRT1413865	hsa-miR-548ah	CLIP-seq
MIRT2124181	hsa-miR-548b-3p	CLIP-seq
MIRT1413866	hsa-miR-548c-3p	CLIP-seq
MIRT1413867	hsa-miR-548p	CLIP-seq
MIRT1413869	hsa-miR-561	CLIP-seq
MIRT1413871	hsa-miR-570	CLIP-seq
MIRT1413872	hsa-miR-579	CLIP-seq
MIRT2124182	hsa-miR-590-3p	CLIP-seq
MIRT1413874	hsa-miR-600	CLIP-seq
MIRT1413875	hsa-miR-603	CLIP-seq
MIRT1413876	hsa-miR-605	CLIP-seq
MIRT1413878	hsa-miR-645	CLIP-seq
MIRT1413880	hsa-miR-655	CLIP-seq
MIRT1413881	hsa-miR-657	CLIP-seq
MIRT1413882	hsa-miR-764	CLIP-seq
MIRT1413884	hsa-miR-770-5p	CLIP-seq
MIRT1413885	hsa-miR-873	CLIP-seq
MIRT2124183	hsa-miR-875-3p	CLIP-seq
MIRT1413886	hsa-miR-93	CLIP-seq
MIRT1413887	hsa-miR-935	CLIP-seq
MIRT1413888	hsa-miR-943	CLIP-seq
MIRT1413742	hsa-miR-106a	CLIP-seq
MIRT1413743	hsa-miR-106b	CLIP-seq
MIRT1413746	hsa-miR-1304	CLIP-seq
MIRT1413747	hsa-miR-132	CLIP-seq
MIRT1413748	hsa-miR-141	CLIP-seq
MIRT1413749	hsa-miR-142-5p	CLIP-seq
MIRT1413750	hsa-miR-15a	CLIP-seq
MIRT1413751	hsa-miR-15b	CLIP-seq
MIRT1413752	hsa-miR-16	CLIP-seq
MIRT1413753	hsa-miR-17	CLIP-seq
MIRT1413754	hsa-miR-181a	CLIP-seq
MIRT1413755	hsa-miR-181b	CLIP-seq
MIRT1413756	hsa-miR-181c	CLIP-seq
MIRT1413757	hsa-miR-181d	CLIP-seq
MIRT1413760	hsa-miR-195	CLIP-seq
MIRT1413761	hsa-miR-200a	CLIP-seq
MIRT1413763	hsa-miR-20a	CLIP-seq
MIRT1413764	hsa-miR-20b	CLIP-seq
MIRT1413765	hsa-miR-212	CLIP-seq
MIRT1413766	hsa-miR-2278	CLIP-seq
MIRT1413767	hsa-miR-23a	CLIP-seq
MIRT1413768	hsa-miR-23b	CLIP-seq
MIRT1413769	hsa-miR-23c	CLIP-seq
MIRT1413771	hsa-miR-3065-5p	CLIP-seq
MIRT1413772	hsa-miR-3119	CLIP-seq
MIRT1413774	hsa-miR-3121-3p	CLIP-seq
MIRT1413778	hsa-miR-323-3p	CLIP-seq
MIRT1413780	hsa-miR-33a	CLIP-seq
MIRT1413781	hsa-miR-33b	CLIP-seq
MIRT1413782	hsa-miR-340	CLIP-seq
MIRT1413784	hsa-miR-3607-3p	CLIP-seq
MIRT1413785	hsa-miR-3609	CLIP-seq
MIRT1413788	hsa-miR-3653	CLIP-seq
MIRT2124161	hsa-miR-3658	CLIP-seq
MIRT1413790	hsa-miR-3665	CLIP-seq
MIRT1413791	hsa-miR-3675-3p	CLIP-seq
MIRT1413793	hsa-miR-3686	CLIP-seq
MIRT1413795	hsa-miR-3692	CLIP-seq
MIRT1413799	hsa-miR-374c	CLIP-seq
MIRT1413802	hsa-miR-3942-5p	CLIP-seq
MIRT1413803	hsa-miR-3973	CLIP-seq
MIRT1413805	hsa-miR-410	CLIP-seq
MIRT1413806	hsa-miR-421	CLIP-seq
MIRT1413807	hsa-miR-424	CLIP-seq
MIRT1413808	hsa-miR-4262	CLIP-seq
MIRT1413809	hsa-miR-4272	CLIP-seq
MIRT2124165	hsa-miR-431	CLIP-seq
MIRT1413811	hsa-miR-4328	CLIP-seq
MIRT1413815	hsa-miR-4452	CLIP-seq
MIRT1413816	hsa-miR-4474-3p	CLIP-seq
MIRT1413817	hsa-miR-4490	CLIP-seq
MIRT1413819	hsa-miR-4504	CLIP-seq
MIRT2124168	hsa-miR-4511	CLIP-seq
MIRT1413821	hsa-miR-451b	CLIP-seq
MIRT1413826	hsa-miR-4645-3p	CLIP-seq
MIRT1413828	hsa-miR-4652-3p	CLIP-seq
MIRT1413834	hsa-miR-4684-5p	CLIP-seq
MIRT1413835	hsa-miR-4703-5p	CLIP-seq
MIRT1413836	hsa-miR-4704-5p	CLIP-seq
MIRT1413837	hsa-miR-4709-5p	CLIP-seq
MIRT2124173	hsa-miR-4735-5p	CLIP-seq
MIRT2124174	hsa-miR-4773	CLIP-seq
MIRT1413841	hsa-miR-4774-5p	CLIP-seq
MIRT2124175	hsa-miR-4775	CLIP-seq
MIRT1413846	hsa-miR-4796-3p	CLIP-seq
MIRT1413850	hsa-miR-497	CLIP-seq
MIRT1413851	hsa-miR-498	CLIP-seq
MIRT1413854	hsa-miR-514	CLIP-seq
MIRT1413855	hsa-miR-514b-3p	CLIP-seq
MIRT1413857	hsa-miR-519a	CLIP-seq
MIRT1413858	hsa-miR-519b-3p	CLIP-seq
MIRT1413859	hsa-miR-519c-3p	CLIP-seq
MIRT1413860	hsa-miR-519d	CLIP-seq
MIRT1413861	hsa-miR-520g	CLIP-seq
MIRT1413862	hsa-miR-520h	CLIP-seq
MIRT1413864	hsa-miR-543	CLIP-seq
MIRT1413865	hsa-miR-548ah	CLIP-seq
MIRT2124181	hsa-miR-548b-3p	CLIP-seq
MIRT1413866	hsa-miR-548c-3p	CLIP-seq
MIRT1413867	hsa-miR-548p	CLIP-seq
MIRT1413871	hsa-miR-570	CLIP-seq
MIRT1413872	hsa-miR-579	CLIP-seq
MIRT2124182	hsa-miR-590-3p	CLIP-seq
MIRT1413874	hsa-miR-600	CLIP-seq
MIRT1413876	hsa-miR-605	CLIP-seq
MIRT1413878	hsa-miR-645	CLIP-seq
MIRT1413880	hsa-miR-655	CLIP-seq
MIRT1413881	hsa-miR-657	CLIP-seq
MIRT1413882	hsa-miR-764	CLIP-seq
MIRT1413885	hsa-miR-873	CLIP-seq
MIRT1413886	hsa-miR-93	CLIP-seq
MIRT1413887	hsa-miR-935	CLIP-seq
MIRT1413742	hsa-miR-106a	CLIP-seq
MIRT1413743	hsa-miR-106b	CLIP-seq
MIRT1413753	hsa-miR-17	CLIP-seq
MIRT1413763	hsa-miR-20a	CLIP-seq
MIRT1413764	hsa-miR-20b	CLIP-seq
MIRT1413815	hsa-miR-4452	CLIP-seq
MIRT1413843	hsa-miR-4786-5p	CLIP-seq
MIRT1413860	hsa-miR-519d	CLIP-seq
MIRT1413873	hsa-miR-591	CLIP-seq
MIRT1413883	hsa-miR-769-5p	CLIP-seq
MIRT1413886	hsa-miR-93	CLIP-seq
MIRT1413746	hsa-miR-1304	CLIP-seq
MIRT1413748	hsa-miR-141	CLIP-seq
MIRT1413761	hsa-miR-200a	CLIP-seq
MIRT1413754	hsa-miR-181a	CLIP-seq
MIRT1413755	hsa-miR-181b	CLIP-seq
MIRT1413756	hsa-miR-181c	CLIP-seq
MIRT1413757	hsa-miR-181d	CLIP-seq
MIRT2639169	hsa-miR-219-1-3p	CLIP-seq
MIRT2124158	hsa-miR-3120-5p	CLIP-seq
MIRT1413778	hsa-miR-323-3p	CLIP-seq
MIRT1413808	hsa-miR-4262	CLIP-seq
MIRT1413812	hsa-miR-4420	CLIP-seq
MIRT2124167	hsa-miR-4434	CLIP-seq
MIRT1413815	hsa-miR-4452	CLIP-seq
MIRT1413817	hsa-miR-4490	CLIP-seq
MIRT2124169	hsa-miR-4516	CLIP-seq
MIRT2639170	hsa-miR-4527	CLIP-seq
MIRT2124170	hsa-miR-4531	CLIP-seq
MIRT1413828	hsa-miR-4652-3p	CLIP-seq
MIRT1413830	hsa-miR-4659a-3p	CLIP-seq
MIRT1413831	hsa-miR-4659b-3p	CLIP-seq
MIRT2639171	hsa-miR-4680-3p	CLIP-seq
MIRT1413841	hsa-miR-4774-5p	CLIP-seq
MIRT2124178	hsa-miR-4802-5p	CLIP-seq
MIRT2639172	hsa-miR-5096	CLIP-seq
MIRT1413853	hsa-miR-513a-3p	CLIP-seq
MIRT1413864	hsa-miR-543	CLIP-seq
MIRT2639173	hsa-miR-571	CLIP-seq
MIRT2639174	hsa-miR-576-5p	CLIP-seq
MIRT1413887	hsa-miR-935	CLIP-seq
MIRT2124167	hsa-miR-4434	CLIP-seq
MIRT2124169	hsa-miR-4516	CLIP-seq
MIRT2124170	hsa-miR-4531	CLIP-seq
MIRT1413830	hsa-miR-4659a-3p	CLIP-seq
MIRT1413831	hsa-miR-4659b-3p	CLIP-seq
MIRT2124178	hsa-miR-4802-5p	CLIP-seq
MIRT1413853	hsa-miR-513a-3p	CLIP-seq

Show/Hide all (5)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003008	Process	System process	IEA
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IEA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	22354992

MIM	HGNC	e!Ensembl
618035	21710	ENSG00000109436

Q6ZT07

Protein name

TBC1 domain family member 9 (TBC1 domain family member 9A)

Protein function

May act as a GTPase-activating protein for Rab family protein(s).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02893	GRAM	146 → 254	GRAM domain	Domain
PF02893	GRAM	293 → 404	GRAM domain	Domain
PF00566	RabGAP-TBC	518 → 722	Rab-GTPase-TBC domain	Family

Sequence

MWVNPEEVLLANALWITERANPYFILQRRKGHAGDGGGGGGLAGLLVGTLDVVLDSSARV
APYRILYQTPDSLVYWTIACGGSRKEITEHWEWLEQNLLQTLSIFENENDITTFVRGKIQ
GIIAEYNKINDVKEDDDTEKFKEAIVKFHRLFGMPEEEKLVNYYSCSYWKGKVPRQGWMY
LSINHLCFYSFLMGREAKLVIRWVDITQLEKNATLLLPDVIKVSTRSSEHFFSVFLNINE
TFKLMEQLANIAMRQLLDNEGFEQDRSLPKLKRKSPKKVSALKRDLDARAKSERYRALFR
LPKDEKLDGHTDCTLWTPFNKMHILGQMFVSTNYICFTSKEENLCSLIIPLREVTIVEKA
DSSSVLPSPLSISTRNRMTFLFANLKDRDFLVQRISDFLQQTTSKIYSDKEFAGSYNSSD
DEVYSRPSSLVSSSPQRSTSSDADGERQFNLNGNSVPTATQTLMTMYRRRSPEEFNPKLA
KEFLKEQAWKIHFAEYGQGICMYRTEKTRELVLKGIPESMRGELWLLLSGAINEKATHPG
YYEDLVEKSMGKYNLATEEIERDLHRSLPEHPAFQNEMGIAALRRVLTAYAFRNPNIGYC
QAMNIVTSVLLLYAKEEEAFWLLVALCERMLPDYYNTRVVGALVDQGVFEELARDYVPQL
YDCMQDLGVISTISLSWFLTLFLSVMPFESAVVVVDCFFYEGIKVIFQLALAVLDANVDK
LLNCKDDGEAMTVLGRYLDSVTNKDSTLPPIPHLHSLLSDDVEPYPEVDIFRLIRTSYEK
FGTIRADLIEQMRFKQRLKVIQTLEDTTKRNVVRTIVTETSFTIDELEELYALFKAEHLT
SCYWGGSSNALDRHDPSLPYLEQYRIDFEQFKGMFALLFPWACGTHSDVLASRLFQLLDE
NGDSLINFREFVSGLSAACHGDLTEKLKLLYKMHVLPEPSSDQDEPDSAFEATQYFFEDI
TPECTHVVGLDSRSKQGADDGFVTVSLKPDKGKRANSQENRNYLRLWTPENKSKSKNAKD
LPKLNQGQFIELCKTMYNMFSEDPNEQELYHATAAVTSLLLEIGEVGKLFVAQPAKEGGS
GGSGPSCHQGIPGVLFPKKGPGQPYVVESVEPLPASLAPDSEEHSLGGQMEDIKLEDSSP
RDNGACSSMLISDDDTKDDSSMSSYSVLSAGSHEEDKLHCEDIGEDTVLVRSGQGTAALP
RSTSLDRDWAITFEQFLASLLTEPALVKYFDKPVCMMARITSAKNIRMMGKPLTSASDYE
ISAMSG

Sequence length

1266

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention deficit hyperactivity disorder	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (314)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	19784880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	2202383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	10500774, 11185984, 12028995, 1283551, 1380280, 16614510, 1859877, 21133625, 22037714, 24804815, 2564311, 7808005, 8100604, 8477061, 8528050 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	11323101, 11531016, 12028995, 12410571, 1283551, 12851703, 15102684, 15543372, 16206189, 16522547, 16849280, 17875533, 18243305, 18385010, 19317599 View all (22 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	10214864, 10500792, 11986944, 12010657, 12926083, 15109536, 15217827, 18001833, 19288261, 27821506, 29469608, 30674943, 8891227, 9368475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	BEFREE	10500792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	16223781, 7516029, 9516145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	1444203, 15070089, 16819187, 2481665, 3681376, 7669560, 9066608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	10399951, 12788075, 1673331, 17003290, 17340576, 22363234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	15070089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	18054347, 26515462, 27995666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	19250544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	19250544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	10987283, 16166436, 16323173, 29805510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	BEFREE	30650062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	1675220, 30650062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	11531016, 12410571, 12851703, 16382213, 16522547, 17875533, 18385010, 19352661, 19467705, 20423567, 22037714, 23244145, 25661341, 2765667, 7694687, 7914748, 9671132, 9886170 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	10214864, 11986944, 12010657, 15217827, 17340137, 17688368, 18644389, 31307954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	23088763, 26211578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	26261589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	21762523, 25840583, 31811017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	18473730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	9516147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	30650062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agranulocytosis	Agranulocytosis	BEFREE	17683514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	17211591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	27915995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	9020393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	20596658, 7812988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgenetic Alopecia	Androgenetic Alopecia	BEFREE	29679725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	30650062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	17429576, 9020393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	28332277	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	20166790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10773966, 10773967, 17290357, 21847519, 28154898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	BEFREE	11466205		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	11260300, 21300134, 26376998, 28587395		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	17085864, 1972761, 8241511, 9074409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Balkan Nephropathy	Balkan Nephropathy	BEFREE	14752243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	22705826, 24898446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	15342374, 15930345, 16323173, 18242387, 24344919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	18165917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	11156211, 20689757, 21292509, 26717965, 7734314, 7908215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	1976871, 2639725, 7914748, 9031075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	10088973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	10678554, 1346632, 1682428, 28137267, 8645582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	7905787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10369069, 10381498, 10597187, 11346468, 11355955, 11391630, 11466674, 11803466, 12894558, 1359153, 15102684, 15113040, 15113052, 16047355, 1612774 View all (83 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23819905, 33080569, 40644891	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	19484794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	BEFREE	23152970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	7905944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10446694, 10656626, 1359152, 15262134, 15379935, 1676033, 1697346, 17177989, 1835847, 19250544, 1977924, 22154301, 2481665, 7904313, 7915508, 8398695, 8431845, 9337699, 9816292 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	11156211, 20689757, 20840328, 21292509, 26717965, 7734314, 7908215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10399954, 11305953, 11724293, 11745426, 17259654, 19484794, 22473764, 24781824, 25563194, 26288241, 2746668, 7829527, 7912240, 8980392, 9066608, 9713512 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma testes	Testicular carcinoma	BEFREE	9669816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	11780384, 11863219, 1359152, 16288028, 16467099, 17001177, 17913048, 18765553, 1973872, 21618519, 21741695, 22209976, 22842366, 25515492, 25687880 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	20453713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	22177087, 22810051		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	1697346, 22245869, 28447725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	22245869, 28447725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	11531016, 12410571, 12851703, 15059065, 15543372, 15717687, 16522547, 17548681, 17568669, 17875533, 18385010, 19317599, 19352661, 19467705, 19774638 View all (13 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	11986944, 12430927, 17340137, 17688368, 18228020, 31307954, 8709631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	26261589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	18473730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	28422725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholecystitis	Cholecystitis	BEFREE	15138130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	21143841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	16445700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic granulomatous disease	Granulomatous Disease	BEFREE	8547675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	17376299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic leukemia (category)	Leukemia	BEFREE	9150348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10456659, 1347708, 1360821, 17085864, 1709806, 17107902, 1911388, 1972761, 20496015, 21463115, 22236186, 7911547, 7914128, 7954350, 8241511, 9074409, 9150348, 9671131, 9722297 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	9746764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	21243282, 29791609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	8409332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear cell sarcoma of kidney	Sarcoma Of Kidney	BEFREE	12007018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne Syndrome	BEFREE	11077043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type I	Cockayne Syndrome	BEFREE	8099135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	14610718, 16773678, 19288029, 28401939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10399951, 11052631, 12370750, 12625868, 12788075, 12894558, 15742416, 15912392, 1681110, 17003290, 17163579, 17237282, 17262809, 1735085, 17674045 View all (24 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	17674045, 7513140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11323103, 11901227, 12297834, 12894567, 15222051, 1537074, 15742416, 16702732, 16800822, 17146660, 17674045, 18474294, 19250544, 1967320, 1977924 View all (26 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	11980438, 17146660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36164444	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	27999186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital absence of vas deferens	Absent vas deferens	BEFREE	11466205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	10088973, 10949987, 11237063, 11426533, 12010657, 17107902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	23167387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	21183151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Mesoblastic Nephroma	Congenital Mesoblastic Nephroma	BEFREE	12007018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10379790, 14685825, 1677434, 17177989, 20510207, 22931984, 24335094, 2724349, 28971329, 7820144, 9700723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	17112805, 23816407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	17112805, 23816407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	17112805, 21183151, 23816407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	15102868, 15505619, 15685540, 16374256, 16434479, 17255827, 17260353, 17262810, 17665184, 18819034, 19107781, 22661185, 23537364, 24449364, 25346426, 27603561, 29262351 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	10419815, 7914197, 9239684, 9344878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Delusions	Delusions	BEFREE	24918524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	17142980, 24577069, 29754150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28206854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	23803106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	23088763, 23339364, 26211578, 26286835, 28339079, 9607591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	8766529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	8766529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	BEFREE	18644389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	17700364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	16047355, 17300681, 24100466, 8847137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsies, Partial	Epilepsy	BEFREE	25223475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	12699350, 15679503, 15857428, 16386926, 16542858, 17917461, 18812236, 20448249, 23465586, 23984379, 24213830, 24300029, 24553780, 24953225, 25223475 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	16499746, 24590840, 25458099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	17913048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	12089380, 25712147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erythema Nodosum	Erythema nodosum	BEFREE	24898446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	16702732, 8052486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	16702732, 8052486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	7903154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma-primitive neuroectodermal tumor (PNET)	Ewing sarcoma	BEFREE	1346632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	BEFREE	7578409, 9209454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	BEFREE	22239287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	8601564, 8727096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	8625237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	15138130, 28492560, 31272718, 9893638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ganglioneuroma	Ganglioneuroma	BEFREE	8727096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	18644389, 20464493, 27611887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	17262809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	BEFREE	22239287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Genitourinary Cancer	Genitourinary Cancer	BEFREE	17701008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10639573, 11857404, 12958161, 15947495, 18568776, 18687982, 19832037, 25053824, 25823028, 28137267, 8883415, 9020393, 9413166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10639573, 11857404, 12958161, 15947495, 18568776, 18687982, 19832037, 25053824, 25823028, 8883415, 9020393, 9413166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10589784, 15947495, 1723831, 18647494, 2294193, 23934261, 24815474, 28380412, 7952498, 9179912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	12967327, 16584389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatous Disease, Chronic, X-Linked	Granulomatous Disease	BEFREE	12731085, 8547675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	20146171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	1972761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	BEFREE	18257092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	25346426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Harlequin Fetus	Harlequin Ichthyosis	BEFREE	16783494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	12460464, 9497311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	10500782, 10695666, 15560070, 16157201, 29145976, 7600845, 7642463, 9408955, 9541688, 9834236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	15203864, 26790444, 29696003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	10392899, 11156211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	10427140, 12365029, 12407543, 14512701, 16020127, 9713521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	28805879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	15560070, 21762523, 25840583, 31811017, 8535196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	10823891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	9815963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia	Hyperbilirubinemia	BEFREE	20504240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	23677857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	16002074		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	16002074		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperoxaluria	Hyperoxaluria	BEFREE	26560472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28656587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	30526541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	29689707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	25559283, 26154535, 28614261, 31305689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ileitis	Ileitis	BEFREE	29262351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	18514101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	12967327, 14610718, 15102868, 15505619, 16374256, 16434479, 16494108, 16633048, 16773678, 16990202, 17100974, 17242936, 17255827, 17260353, 17505995 View all (17 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Meningioma	Intracranial Meningioma	BEFREE	14723263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	19879256, 23280016, 25062490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	23537364, 25346426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	22810051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kernicterus	Kernicterus	BEFREE	18713069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	25840583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	17043887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	17376299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	12089380, 14752243		★★★★★ ★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	8601564		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10070877, 10342576, 10360380, 10360822, 10362143, 10500781, 10581184, 10695666, 11185984, 11734301, 11774737, 12609962, 1380280, 14567978, 15294454 View all (38 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10214864, 10360380, 10374860, 10400187, 10419902, 10500792, 10625494, 10695821, 11167822, 11237063, 11355932, 11369657, 11986944, 12010657, 12028995 View all (80 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	11426620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	2573831, 27533339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	24247158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipomatosis	Lipomatosis	BEFREE	8727096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipomatosis, Multiple Symmetrical	Lipomatosis	BEFREE	8727096		★★★★★ ★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	23047249, 25576094, 8601564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10427140, 10551471, 11057761, 11354286, 11579388, 11960367, 12297834, 12428063, 12854138, 15112342, 15948236, 16161006, 16237754, 16481289, 1676033 View all (27 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	8409332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	29559914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	11057761, 11960367, 16237754, 22363234, 7908989, 8102093, 8409332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	7915180, 7915508, 8095859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	18214345, 28154898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphadenitis	Lymphadenitis	BEFREE	1766262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	15102684, 24142546, 7910222, 8075575, 8535665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10766353, 11755462, 12017290, 15161039, 15725475, 16093797, 1766262, 19414348, 20393003, 23768637, 2562856, 7632959, 7786606, 7905944, 7961124 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	23339364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	2323839, 24053936, 24756092, 9722297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	2323839, 24756092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	9722297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	18550244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	7833115, 7904171, 8601564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	12460464, 9497311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of adrenal cortex	Adrenocortical carcinoma	BEFREE	1675220, 30650062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10092063, 10369069, 10381498, 10597187, 11391630, 11803466, 1359153, 15102684, 15113040, 15113052, 16434992, 16518057, 16786442, 16925584, 17352222 View all (70 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	17300681, 24100466, 8847137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	16702732, 8052486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	15138130, 28492560, 9893638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	1735085, 20699370, 8637212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	20840328, 22358302, 3681376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	11960367, 24647772, 26261589, 30066890, 8409332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11305953, 11724293, 11745426, 1374598, 17259654, 19484794, 22473764, 25563194, 26288241, 2746668, 7912240, 8980392, 9066608, 9713512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	24247158, 30352381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	10656626, 11780384, 11863219, 1359152, 16288028, 16467099, 17001177, 18765553, 1973872, 21618519, 21741695, 22209976, 22842366, 25515492, 25687880 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11039467, 15138133, 24288256, 8766529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15026333, 15342374, 16166436, 18242387, 23906293, 24085442, 24344919, 25544376, 8105110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	10446694, 11205224, 15756676, 1735085, 17608636, 18644389, 19331170, 20636108, 22641402, 23801278, 24116826, 24377601, 24515389, 24815441, 26292288, 27612427, 29137307, 9649010, 9677442 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	23803106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	11156211, 20689757, 21292509, 26717965, 7734314, 7908215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10427140, 10430060, 10500782, 10589744, 10745175, 10918491, 11205224, 11857422, 11915030, 11920626, 12142082, 12708467, 15026333, 15051924, 15203864 View all (96 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	15609299, 8727096, 9216701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	17374987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	22245869, 28447725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10399951, 11052631, 12370750, 15742416, 15912392, 1681110, 17003290, 1735085, 17674045, 18644389, 18673531, 20186172, 21084030, 21204761, 22154301 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11501838, 12576456, 15102684, 19047049, 1970934, 23481629, 28212576, 8251651, 9214671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	14583799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	7756676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	10894369, 18473730		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11298532, 11525950, 16034303, 7960246, 9635679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	17142980, 24577069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	25646961	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	25646961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	27288795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	15020609		★★★★★ ★☆☆☆☆ Found in Text Mining only
MOHR-TRANEBJAERG SYNDROME	MOHR-TRANEBJAERG SYNDROME	BEFREE	31659146		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	17142980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	10088973, 10809991, 12180485, 15739024, 16929535, 17488488, 18408561, 18639335, 26790444, 27039718, 28339079, 28676669, 28888211, 29495954, 8094626, 8238918, 8520514 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	18717915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	23684483		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	10695666, 15020609, 16566920, 23684483, 7901457, 7915092, 8011551, 8100604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	8105147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	12010657, 1773788, 21677772, 24142546, 3481435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	16157201, 18524988, 1972761, 1976871, 20204543, 20206383, 2304354, 23683876, 24524306, 24798723, 25087925, 25393253, 2562856, 2639725, 26634458 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	9746764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	19784880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Type Extranodal NK/T-Cell Lymphoma	Extranodal NK T Cell Lymphoma	BEFREE	23768637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	25900553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10210147, 10379790, 10425316, 10427140, 10446694, 10463770, 10473106, 10589744, 10629655, 10656626, 10678554, 10803921, 10880020, 10930086, 11039467 View all (164 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	2224796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	10392899, 11734301, 14962262, 20187302, 20423567, 9127318		★★★★★ ★☆☆☆☆ Found in Text Mining only
NEPHROLITHIASIS, CALCIUM OXALATE	Nephronophthisis	BEFREE	26560472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	21460357, 21525574, 21553324, 23994685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome, Minimal Change	Nephrotic Syndrome	BEFREE	25559283, 26154535, 28614261, 31305689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10536185, 1374683, 1678252, 17387584, 18713069, 1974410, 2185879, 2295903, 23483136, 23934188, 2562856, 2573830, 2778826, 7891222, 7923112, 8174136, 9317175, 9516848 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	10894369, 1346632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	1374598, 15277258, 16572896, 17593626, 17851225, 18812689, 20189873, 20627363, 21827803, 22296372, 22766400, 22932088, 24933103, 2562856, 27706681 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	11466205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Mucositis	Oral Mucositis	BEFREE	23244145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	10321019, 10500782, 10597187, 10894867, 12695554, 15547696, 17279585, 21780101, 21868524, 24491996, 25747987, 27176642, 28693150, 30114619, 7735558 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian adenocarcinoma	Ovarian adenocarcinoma	BEFREE	12473588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	11780384, 11863219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Mucinous Adenocarcinoma	Ovarian adenocarcinoma	BEFREE	27060927		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	1359152, 16288028, 16467099, 17001177, 18765553, 1973872, 21618519, 21741695, 22209976, 22842366, 25515492, 25687880, 25964202, 26053275, 28148293 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	22924580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11039467, 15138133, 22367292, 24288256, 8766529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	8766529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Adenoma	Parathyroid Adenoma	BEFREE	17299072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	12724617, 15542248, 15767512, 18855017, 19184162, 19255821, 22971641, 23987116, 27538645, 28412655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	12724617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	BEFREE	18644389, 24815441, 27611887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peroxisome Biogenesis Disorder, Complementation Group D	Zellweger Syndrome	BEFREE	8547675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	20166790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	17429576, 28137267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	15235109, 7694687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	11323101, 12028995, 12410571, 1283551, 12851703, 15102684, 15543372, 16849280, 19317599, 23244145, 24142546, 29377275, 7694687, 7905944, 7910222, 8075575 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	20423567, 7694687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	12763363, 15690482, 16584389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	15700834, 1682428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	17100974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15026333, 15342374, 16166436, 18242387, 23906293, 24085442, 24344919, 25544376, 7904313, 8105110		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	1682428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	9935221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	24734954, 7580102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	20840328, 22358302, 3681376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10379790, 12017273, 14685825, 1677434, 17177989, 20510207, 22931984, 24335094, 2724349, 3352061, 3681376, 7820144, 9700723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	18408564, 23107770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	14654923, 15015604, 16652192, 9455797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	16932953, 20080907, 21947347, 24734954, 26071279, 7580102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	10473106, 12112526, 12426490, 1606072, 1859877, 7803538, 7903154, 7904171, 8695249, 8727096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	36232302	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizoaffective Disorder	Schizoaffective Disorder	BEFREE	20060871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	16386826, 17113599, 17142980, 18543120, 20060871, 20143052, 20195292, 24918524		★★★★★ ★☆☆☆☆ Found in Text Mining only
secondary acute myeloid leukemia	Myeloid leukemia	BEFREE	12010657, 1283551, 7808005, 9129038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	19862647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	28325287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sexual Dysfunction	Sexual Dysfunction	BEFREE	23152970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	35359935	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	24898446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Central	Sleep Apnea	BEFREE	8099135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	10100721, 10815935, 16478794, 20047843, 21163134, 2571355, 9066608, 9256898, 9377550, 9751266, 9815546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	8601564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sphenoid Wing Meningioma	Sphenoid Wing Meningioma	BEFREE	1682428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	17549370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	1374598, 15375553, 17374987, 1970934, 30352381, 7669560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	15197778, 26823755, 29107111, 29340044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	10744048, 22180460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steroid resistant nephrotic syndrome of childhood	Steroid resistant nephrotic syndrome	BEFREE	21460357, 21974705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	29689707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steroid-sensitive nephrotic syndrome	Steroid-Sensitive Nephrotic Syndrome	BEFREE	17043887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	10446694, 11205224, 15375376, 15649014, 15756676, 1735085, 17608636, 18644389, 19331170, 20636108, 22641402, 23801278, 24116826, 24377601, 24515389 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	BEFREE	23244145		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	28606042		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Prolymphocytic Leukemia	T-Cell Prolymphocytic Leukemia	BEFREE	1972761		★★★★★ ★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	8648821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	23803106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	20844484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31742868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	32591639	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	10580886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	12512026, 15102868, 15505619, 15685540, 16374256, 16434479, 16462040, 17206635, 17242936, 17255827, 17260353, 17262809, 17665184, 17828778, 18819034 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	18550244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	9635679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vaginitis	Vaginitis	BEFREE	16006060		★★★★★ ★☆☆☆☆ Found in Text Mining only
X-Linked Combined Immunodeficiency Diseases	Combined Immunodeficiency, X-Linked	BEFREE	9797872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma pigmentosum, group B	Xeroderma Pigmentosum	BEFREE	11077043		★★★★★ ★☆☆☆☆ Found in Text Mining only

TBC1D9 (TBC1 domain family member 9)