LRCH1 (leucine rich repeats and calponin homology domain containing 1)

Gene

• Entrez ID: 23143
• Gene name: Leucine rich repeats and calponin homology domain containing 1
• Gene symbol: LRCH1
• Synonyms (NCBI Gene): CHDC1, NP81
• Chromosome: 13
• Chromosome location: 13q14.13-q14.2
• Summary: This gene encodes a protein with a leucine-rich repeat and a calponin homology domain. Polymorphism in this gene may be associated with susceptibililty to knee osteoarthritis. Alternative splicing results in multiple transcript variants encoding different

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT664088	hsa-miR-4517	HITS-CLIP	23824327
MIRT664087	hsa-miR-5583-3p	HITS-CLIP	23824327
MIRT641222	hsa-miR-654-3p	HITS-CLIP	23824327
MIRT641221	hsa-miR-6884-3p	HITS-CLIP	23824327
MIRT641220	hsa-miR-6830-3p	HITS-CLIP	23824327
MIRT641219	hsa-miR-511-5p	HITS-CLIP	23824327
MIRT641218	hsa-miR-587	HITS-CLIP	23824327
MIRT641222	hsa-miR-654-3p	HITS-CLIP	23824327
MIRT641221	hsa-miR-6884-3p	HITS-CLIP	23824327
MIRT641220	hsa-miR-6830-3p	HITS-CLIP	23824327
MIRT641219	hsa-miR-511-5p	HITS-CLIP	23824327
MIRT641218	hsa-miR-587	HITS-CLIP	23824327
MIRT664088	hsa-miR-4517	HITS-CLIP	23824327
MIRT664087	hsa-miR-5583-3p	HITS-CLIP	23824327
MIRT641222	hsa-miR-654-3p	HITS-CLIP	23824327
MIRT641221	hsa-miR-6884-3p	HITS-CLIP	23824327
MIRT641220	hsa-miR-6830-3p	HITS-CLIP	23824327
MIRT641219	hsa-miR-511-5p	HITS-CLIP	23824327
MIRT641218	hsa-miR-587	HITS-CLIP	23824327
MIRT641222	hsa-miR-654-3p	HITS-CLIP	23824327
MIRT641221	hsa-miR-6884-3p	HITS-CLIP	23824327
MIRT641220	hsa-miR-6830-3p	HITS-CLIP	23824327
MIRT641219	hsa-miR-511-5p	HITS-CLIP	23824327
MIRT641218	hsa-miR-587	HITS-CLIP	23824327
MIRT1117272	hsa-miR-101	CLIP-seq
MIRT1117273	hsa-miR-106a	CLIP-seq
MIRT1117274	hsa-miR-106b	CLIP-seq
MIRT1117275	hsa-miR-1207-3p	CLIP-seq
MIRT1117276	hsa-miR-1273d	CLIP-seq
MIRT1117277	hsa-miR-129-5p	CLIP-seq
MIRT1117278	hsa-miR-1297	CLIP-seq
MIRT1117279	hsa-miR-130a	CLIP-seq
MIRT1117280	hsa-miR-130b	CLIP-seq
MIRT1117281	hsa-miR-137	CLIP-seq
MIRT1117282	hsa-miR-148a	CLIP-seq
MIRT1117283	hsa-miR-148b	CLIP-seq
MIRT1117284	hsa-miR-152	CLIP-seq
MIRT1117285	hsa-miR-154	CLIP-seq
MIRT1117286	hsa-miR-17	CLIP-seq
MIRT1117287	hsa-miR-181a	CLIP-seq
MIRT1117288	hsa-miR-181b	CLIP-seq
MIRT1117289	hsa-miR-181c	CLIP-seq
MIRT1117290	hsa-miR-181d	CLIP-seq
MIRT1117291	hsa-miR-19a	CLIP-seq
MIRT1117292	hsa-miR-19b	CLIP-seq
MIRT1117293	hsa-miR-204	CLIP-seq
MIRT1117294	hsa-miR-20a	CLIP-seq
MIRT1117295	hsa-miR-20b	CLIP-seq
MIRT1117296	hsa-miR-211	CLIP-seq
MIRT1117297	hsa-miR-2113	CLIP-seq
MIRT1117298	hsa-miR-218	CLIP-seq
MIRT1117299	hsa-miR-219-5p	CLIP-seq
MIRT1117300	hsa-miR-2355-3p	CLIP-seq
MIRT1117301	hsa-miR-23a	CLIP-seq
MIRT1117302	hsa-miR-23b	CLIP-seq
MIRT1117303	hsa-miR-23c	CLIP-seq
MIRT1117304	hsa-miR-25	CLIP-seq
MIRT1117305	hsa-miR-26a	CLIP-seq
MIRT1117306	hsa-miR-26b	CLIP-seq
MIRT1117307	hsa-miR-301a	CLIP-seq
MIRT1117308	hsa-miR-301b	CLIP-seq
MIRT1117309	hsa-miR-3145-3p	CLIP-seq
MIRT1117310	hsa-miR-3177-5p	CLIP-seq
MIRT1117311	hsa-miR-3187-3p	CLIP-seq
MIRT1117312	hsa-miR-3190	CLIP-seq
MIRT1117313	hsa-miR-32	CLIP-seq
MIRT1117314	hsa-miR-323-3p	CLIP-seq
MIRT1117315	hsa-miR-324-5p	CLIP-seq
MIRT1117316	hsa-miR-34a	CLIP-seq
MIRT1117317	hsa-miR-34c-5p	CLIP-seq
MIRT1117318	hsa-miR-3609	CLIP-seq
MIRT1117319	hsa-miR-363	CLIP-seq
MIRT1117320	hsa-miR-3659	CLIP-seq
MIRT1117321	hsa-miR-3666	CLIP-seq
MIRT1117322	hsa-miR-367	CLIP-seq
MIRT1117323	hsa-miR-3673	CLIP-seq
MIRT1117324	hsa-miR-3911	CLIP-seq
MIRT1117325	hsa-miR-3941	CLIP-seq
MIRT1117326	hsa-miR-3944-5p	CLIP-seq
MIRT1117327	hsa-miR-3978	CLIP-seq
MIRT1117328	hsa-miR-409-3p	CLIP-seq
MIRT1117329	hsa-miR-4262	CLIP-seq
MIRT1117330	hsa-miR-4264	CLIP-seq
MIRT1117331	hsa-miR-4286	CLIP-seq
MIRT1117332	hsa-miR-4295	CLIP-seq
MIRT1117333	hsa-miR-431	CLIP-seq
MIRT1117334	hsa-miR-4313	CLIP-seq
MIRT1117335	hsa-miR-4325	CLIP-seq
MIRT1117336	hsa-miR-4436a	CLIP-seq
MIRT1117337	hsa-miR-4445	CLIP-seq
MIRT1117338	hsa-miR-4465	CLIP-seq
MIRT1117339	hsa-miR-4499	CLIP-seq
MIRT1117340	hsa-miR-449a	CLIP-seq
MIRT1117341	hsa-miR-449b	CLIP-seq
MIRT1117342	hsa-miR-4529-5p	CLIP-seq
MIRT1117343	hsa-miR-454	CLIP-seq
MIRT1117344	hsa-miR-4646-3p	CLIP-seq
MIRT1117345	hsa-miR-4658	CLIP-seq
MIRT1117346	hsa-miR-466	CLIP-seq
MIRT1117347	hsa-miR-4672	CLIP-seq
MIRT1117348	hsa-miR-4678	CLIP-seq
MIRT1117349	hsa-miR-4698	CLIP-seq
MIRT1117350	hsa-miR-4714-3p	CLIP-seq
MIRT1117351	hsa-miR-4731-3p	CLIP-seq
MIRT1117352	hsa-miR-4755-5p	CLIP-seq
MIRT1117353	hsa-miR-4778-5p	CLIP-seq
MIRT1117354	hsa-miR-4782-3p	CLIP-seq
MIRT1117355	hsa-miR-4786-3p	CLIP-seq
MIRT1117356	hsa-miR-4789-5p	CLIP-seq
MIRT1117357	hsa-miR-4796-3p	CLIP-seq
MIRT1117358	hsa-miR-4801	CLIP-seq
MIRT1117359	hsa-miR-494	CLIP-seq
MIRT1117360	hsa-miR-507	CLIP-seq
MIRT1117361	hsa-miR-508-3p	CLIP-seq
MIRT1117362	hsa-miR-510	CLIP-seq
MIRT1117363	hsa-miR-512-5p	CLIP-seq
MIRT1117364	hsa-miR-514	CLIP-seq
MIRT1117365	hsa-miR-514b-3p	CLIP-seq
MIRT1117366	hsa-miR-519a	CLIP-seq
MIRT1117367	hsa-miR-519b-3p	CLIP-seq
MIRT1117368	hsa-miR-519c-3p	CLIP-seq
MIRT1117369	hsa-miR-519d	CLIP-seq
MIRT1117370	hsa-miR-520g	CLIP-seq
MIRT1117371	hsa-miR-520h	CLIP-seq
MIRT1117372	hsa-miR-548ad	CLIP-seq
MIRT1117373	hsa-miR-548ah	CLIP-seq
MIRT1117374	hsa-miR-548l	CLIP-seq
MIRT1117375	hsa-miR-548n	CLIP-seq
MIRT1117376	hsa-miR-553	CLIP-seq
MIRT1117377	hsa-miR-557	CLIP-seq
MIRT1117378	hsa-miR-574-5p	CLIP-seq
MIRT1117379	hsa-miR-582-5p	CLIP-seq
MIRT1117380	hsa-miR-586	CLIP-seq
MIRT1117381	hsa-miR-590-3p	CLIP-seq
MIRT1117382	hsa-miR-623	CLIP-seq
MIRT1117383	hsa-miR-636	CLIP-seq
MIRT1117384	hsa-miR-659	CLIP-seq
MIRT1117385	hsa-miR-889	CLIP-seq
MIRT1117386	hsa-miR-92a	CLIP-seq
MIRT1117387	hsa-miR-92b	CLIP-seq
MIRT1117388	hsa-miR-93	CLIP-seq
MIRT2033117	hsa-miR-1	CLIP-seq
MIRT1117272	hsa-miR-101	CLIP-seq
MIRT2033118	hsa-miR-1185	CLIP-seq
MIRT1117275	hsa-miR-1207-3p	CLIP-seq
MIRT1117276	hsa-miR-1273d	CLIP-seq
MIRT2033119	hsa-miR-1287	CLIP-seq
MIRT2033120	hsa-miR-1293	CLIP-seq
MIRT2033121	hsa-miR-1301	CLIP-seq
MIRT1117279	hsa-miR-130a	CLIP-seq
MIRT1117280	hsa-miR-130b	CLIP-seq
MIRT1117281	hsa-miR-137	CLIP-seq
MIRT1117282	hsa-miR-148a	CLIP-seq
MIRT1117283	hsa-miR-148b	CLIP-seq
MIRT1117284	hsa-miR-152	CLIP-seq
MIRT1117291	hsa-miR-19a	CLIP-seq
MIRT1117292	hsa-miR-19b	CLIP-seq
MIRT2033122	hsa-miR-206	CLIP-seq
MIRT2033123	hsa-miR-216b	CLIP-seq
MIRT1117304	hsa-miR-25	CLIP-seq
MIRT2033124	hsa-miR-2682	CLIP-seq
MIRT2033125	hsa-miR-298	CLIP-seq
MIRT1117307	hsa-miR-301a	CLIP-seq
MIRT1117308	hsa-miR-301b	CLIP-seq
MIRT2033126	hsa-miR-3135b	CLIP-seq
MIRT2033127	hsa-miR-3158-5p	CLIP-seq
MIRT1117310	hsa-miR-3177-5p	CLIP-seq
MIRT1117311	hsa-miR-3187-3p	CLIP-seq
MIRT1117313	hsa-miR-32	CLIP-seq
MIRT2033128	hsa-miR-323-5p	CLIP-seq
MIRT1117316	hsa-miR-34a	CLIP-seq
MIRT1117317	hsa-miR-34c-5p	CLIP-seq
MIRT2033129	hsa-miR-3616-5p	CLIP-seq
MIRT1117319	hsa-miR-363	CLIP-seq
MIRT2033130	hsa-miR-3647-5p	CLIP-seq
MIRT1117321	hsa-miR-3666	CLIP-seq
MIRT1117322	hsa-miR-367	CLIP-seq
MIRT1117323	hsa-miR-3673	CLIP-seq
MIRT2033131	hsa-miR-3679-5p	CLIP-seq
MIRT2033132	hsa-miR-3907	CLIP-seq
MIRT1117326	hsa-miR-3944-5p	CLIP-seq
MIRT2033133	hsa-miR-4276	CLIP-seq
MIRT1117332	hsa-miR-4295	CLIP-seq
MIRT2033134	hsa-miR-4312	CLIP-seq
MIRT2033135	hsa-miR-4446-3p	CLIP-seq
MIRT2033136	hsa-miR-4456	CLIP-seq
MIRT2033137	hsa-miR-4483	CLIP-seq
MIRT2033138	hsa-miR-4496	CLIP-seq
MIRT1117340	hsa-miR-449a	CLIP-seq
MIRT1117341	hsa-miR-449b	CLIP-seq
MIRT2033139	hsa-miR-449c	CLIP-seq
MIRT2033140	hsa-miR-4514	CLIP-seq
MIRT1117342	hsa-miR-4529-5p	CLIP-seq
MIRT1117343	hsa-miR-454	CLIP-seq
MIRT2033141	hsa-miR-4639-5p	CLIP-seq
MIRT2033142	hsa-miR-4692	CLIP-seq
MIRT2033143	hsa-miR-4711-3p	CLIP-seq
MIRT2033144	hsa-miR-4753-3p	CLIP-seq
MIRT2033145	hsa-miR-4763-5p	CLIP-seq
MIRT2033146	hsa-miR-4786-5p	CLIP-seq
MIRT2033147	hsa-miR-4795-5p	CLIP-seq
MIRT2033148	hsa-miR-5047	CLIP-seq
MIRT2033149	hsa-miR-511	CLIP-seq
MIRT2033150	hsa-miR-542-3p	CLIP-seq
MIRT1117374	hsa-miR-548l	CLIP-seq
MIRT1117375	hsa-miR-548n	CLIP-seq
MIRT2033151	hsa-miR-573	CLIP-seq
MIRT1117379	hsa-miR-582-5p	CLIP-seq
MIRT2033152	hsa-miR-583	CLIP-seq
MIRT1117380	hsa-miR-586	CLIP-seq
MIRT2033153	hsa-miR-613	CLIP-seq
MIRT2033154	hsa-miR-769-5p	CLIP-seq
MIRT2033155	hsa-miR-876-3p	CLIP-seq
MIRT2033156	hsa-miR-9	CLIP-seq
MIRT1117386	hsa-miR-92a	CLIP-seq
MIRT1117387	hsa-miR-92b	CLIP-seq
MIRT2033118	hsa-miR-1185	CLIP-seq
MIRT2263505	hsa-miR-3613-3p	CLIP-seq
MIRT1117323	hsa-miR-3673	CLIP-seq
MIRT2033131	hsa-miR-3679-5p	CLIP-seq
MIRT1117325	hsa-miR-3941	CLIP-seq
MIRT2263506	hsa-miR-4469	CLIP-seq
MIRT2263507	hsa-miR-4659a-3p	CLIP-seq
MIRT2263508	hsa-miR-4659b-3p	CLIP-seq
MIRT1117346	hsa-miR-466	CLIP-seq
MIRT1117347	hsa-miR-4672	CLIP-seq
MIRT1117351	hsa-miR-4731-3p	CLIP-seq
MIRT1117356	hsa-miR-4789-5p	CLIP-seq
MIRT1117358	hsa-miR-4801	CLIP-seq
MIRT2263509	hsa-miR-548p	CLIP-seq
MIRT2033152	hsa-miR-583	CLIP-seq
MIRT2263510	hsa-miR-647	CLIP-seq
MIRT2263511	hsa-miR-942	CLIP-seq
MIRT2562819	hsa-miR-1254	CLIP-seq
MIRT2033120	hsa-miR-1293	CLIP-seq
MIRT2562820	hsa-miR-185	CLIP-seq
MIRT2033124	hsa-miR-2682	CLIP-seq
MIRT2562821	hsa-miR-296-3p	CLIP-seq
MIRT2562822	hsa-miR-3116	CLIP-seq
MIRT2562823	hsa-miR-3146	CLIP-seq
MIRT1117316	hsa-miR-34a	CLIP-seq
MIRT1117317	hsa-miR-34c-5p	CLIP-seq
MIRT2562824	hsa-miR-4254	CLIP-seq
MIRT2562825	hsa-miR-4306	CLIP-seq
MIRT2562826	hsa-miR-4468	CLIP-seq
MIRT2033137	hsa-miR-4483	CLIP-seq
MIRT1117340	hsa-miR-449a	CLIP-seq
MIRT1117341	hsa-miR-449b	CLIP-seq
MIRT2033139	hsa-miR-449c	CLIP-seq
MIRT2562827	hsa-miR-4528	CLIP-seq
MIRT2562828	hsa-miR-4644	CLIP-seq
MIRT2562829	hsa-miR-499-3p	CLIP-seq
MIRT2562830	hsa-miR-499a-3p	CLIP-seq
MIRT2562831	hsa-miR-550a	CLIP-seq
MIRT2562832	hsa-miR-552	CLIP-seq
MIRT2562833	hsa-miR-661	CLIP-seq
MIRT2562834	hsa-miR-764	CLIP-seq
MIRT1117301	hsa-miR-23a	CLIP-seq
MIRT1117302	hsa-miR-23b	CLIP-seq
MIRT1117303	hsa-miR-23c	CLIP-seq
MIRT2684121	hsa-miR-3121-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	24255178, 25416956, 28028151, 29467281, 31515488, 32296183, 33961781, 35271311
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	IMP	28028151
GO:0034260	Process	Negative regulation of GTPase activity	IDA	28028151
GO:1990869	Process	Cellular response to chemokine	IBA
GO:1990869	Process	Cellular response to chemokine	IEA
GO:1990869	Process	Cellular response to chemokine	IMP	28028151
GO:2000405	Process	Negative regulation of T cell migration	IBA
GO:2000405	Process	Negative regulation of T cell migration	IEA
GO:2000405	Process	Negative regulation of T cell migration	IMP	28028151

Other IDs

• MIM: 610368
• HGNC: 20309
• e!Ensembl: ENSG00000136141

Protein

• UniProt ID: Q9Y2L9
• Protein name: Leucine-rich repeat and calponin homology domain-containing protein 1 (Calponin homology domain-containing protein 1) (Neuronal protein 81) (NP81)
• Protein function: Acts as a negative regulator of GTPase CDC42 by sequestering CDC42-guanine exchange factor DOCK8. Probably by preventing CDC42 activation, negatively regulates CD4(+) T-cell migration.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13855	LRR_8	103 → 155	Leucine rich repeat	Repeat
  PF13855	LRR_8	166 → 223	Leucine rich repeat	Repeat
  PF13855	LRR_8	211 → 268	Leucine rich repeat	Repeat
  PF00307	CH	576 → 692	Calponin homology (CH) domain	Domain

• Sequence:

  MATPGSEPQPFVPALSVATLHPLHHPHHHHHHHQHHGGTGAPGGAGGGGGGSGGFNLPLN
  RGLERALEEAANSGGLNLSARKLKEFPRTAAPGHDLSDTVQADLSKNRLVEVPMELCHFV
  SLEILNLYHNCIRVIPEAIVNLQMLTYLNLSRNQLSALPACLCGLPLKVLIASNNKLGSL
  PEEIGQLKQLMELDVSCNEITALPQQIGQLKSLRELNVRRNYLKVLPQELVDLSLVKFDF
  SCNKVLVIPICFREMKQLQVLLLENNPLQSPPAQICTKGKVHIFKYLSIQACQIKTADSL
  YLHTMERPHLHQHVEDGKKDSDSGVGSDNGDKRLSATEPSDEDTVSLNVPMSNIMEEEQI
  IKEDSCHRLSPVKGEFHQEFQPEPSLLGDSTNSGEERDQFTDRADGLHSEFMNYKARAED
  CEELLRIEEDVHWQTEGIISSSKDQDMDIAMIEQLREAVDLLQDPNGLSTDITERSVLNL
  YPMGSAEALELQDSALNGQIQLETSPVCEVQSDLTLQSNGSQYSPNEIRENSPAVSPTTN
  STAPFGLKPRSVFLRPQRNLESIDPQFTIRRKMEQMREEKELVEQLRESIEMRLKVSLHE
  DLGAALMDGVVLCHLVNHIRPRSVASIHVPSPAVPKLSMAKCRRNVENFLEACRKLGVPE
  ADLCSPCDILQLDFRHIRKTVDTLLALGEKAPPPTSALRSRDLIGFCLVHILFIVLVYIT
  YHWNALSA

• Sequence length: 728

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BENIGN THYROID GLAND NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR ACCIDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL ARTERIAL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	CTD, GWAS catalog CTD, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Cerebrovascular Accidents	Stroke	CTD_human_DG	29531354		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	24478024		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	24478024		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	CTD_human_DG	29531354		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	GWASCAT_DG	29531354		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chondrosarcoma	Chondrosarcoma	BEFREE	16447229		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	32210709	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24478024		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37365285	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	16447229, 16891653		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	37365285	Associate	★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	31842790		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	35725478	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	GWASCAT_DG	29531354		★☆☆☆☆ Found in Text Mining only
Osteoarthritis Hip	Osteoarthritis	Pubtator	27974301	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	16447229	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	16447229, 16891653, 18049793		★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	LHGDN	16447229		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	34727735	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations