Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	23136
Gene name	Erythrocyte membrane protein band 4.1 like 3
Gene symbol	EPB41L3
Synonyms (NCBI Gene)	4.1BDAL-1DAL1
Chromosome	18
Chromosome location	18p11.31

141

Show/Hide all (141)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006374	hsa-miR-223-3p	Luciferase reporter assayWestern blot	21628394
MIRT006374	hsa-miR-223-3p	Luciferase reporter assayWestern blot	21628394
MIRT006374	hsa-miR-223-3p	Luciferase reporter assayWestern blot	21628394
MIRT051992	hsa-let-7b-5p	CLASH	23622248
MIRT049330	hsa-miR-92a-3p	CLASH	23622248
MIRT037171	hsa-miR-877-3p	CLASH	23622248
MIRT637424	hsa-miR-548u	HITS-CLIP	23824327
MIRT637423	hsa-miR-7161-5p	HITS-CLIP	23824327
MIRT637422	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT637421	hsa-miR-3675-3p	HITS-CLIP	23824327
MIRT637420	hsa-miR-4684-5p	HITS-CLIP	23824327
MIRT551194	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT551193	hsa-miR-551b-5p	PAR-CLIP	21572407
MIRT551192	hsa-miR-5697	PAR-CLIP	21572407
MIRT551191	hsa-miR-4275	PAR-CLIP	21572407
MIRT551190	hsa-miR-627-3p	PAR-CLIP	21572407
MIRT551189	hsa-miR-1297	PAR-CLIP	21572407
MIRT551188	hsa-miR-26a-5p	PAR-CLIP	21572407
MIRT551187	hsa-miR-26b-5p	PAR-CLIP	21572407
MIRT551186	hsa-miR-4465	PAR-CLIP	21572407
MIRT551185	hsa-miR-498	PAR-CLIP	21572407
MIRT551184	hsa-miR-1305	PAR-CLIP	21572407
MIRT637424	hsa-miR-548u	HITS-CLIP	23824327
MIRT637423	hsa-miR-7161-5p	HITS-CLIP	23824327
MIRT637422	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT637421	hsa-miR-3675-3p	HITS-CLIP	23824327
MIRT637420	hsa-miR-4684-5p	HITS-CLIP	23824327
MIRT551194	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT551193	hsa-miR-551b-5p	PAR-CLIP	21572407
MIRT551192	hsa-miR-5697	PAR-CLIP	21572407
MIRT551191	hsa-miR-4275	PAR-CLIP	21572407
MIRT551190	hsa-miR-627-3p	PAR-CLIP	21572407
MIRT551189	hsa-miR-1297	PAR-CLIP	21572407
MIRT551188	hsa-miR-26a-5p	PAR-CLIP	21572407
MIRT551187	hsa-miR-26b-5p	PAR-CLIP	21572407
MIRT551186	hsa-miR-4465	PAR-CLIP	21572407
MIRT551185	hsa-miR-498	PAR-CLIP	21572407
MIRT551184	hsa-miR-1305	PAR-CLIP	21572407
MIRT965659	hsa-miR-125a-3p	CLIP-seq
MIRT965660	hsa-miR-3665	CLIP-seq
MIRT965661	hsa-miR-4434	CLIP-seq
MIRT965662	hsa-miR-4516	CLIP-seq
MIRT965663	hsa-miR-4531	CLIP-seq
MIRT965664	hsa-miR-657	CLIP-seq
MIRT2220517	hsa-miR-4668-3p	CLIP-seq
MIRT2524342	hsa-miR-1179	CLIP-seq
MIRT2524343	hsa-miR-1245	CLIP-seq
MIRT2524344	hsa-miR-1304	CLIP-seq
MIRT2524345	hsa-miR-141	CLIP-seq
MIRT2524346	hsa-miR-151-3p	CLIP-seq
MIRT2524347	hsa-miR-184	CLIP-seq
MIRT2524348	hsa-miR-19a	CLIP-seq
MIRT2524349	hsa-miR-19b	CLIP-seq
MIRT2524350	hsa-miR-200a	CLIP-seq
MIRT2524351	hsa-miR-2054	CLIP-seq
MIRT2524352	hsa-miR-2113	CLIP-seq
MIRT2524353	hsa-miR-217	CLIP-seq
MIRT2524354	hsa-miR-223	CLIP-seq
MIRT2524355	hsa-miR-300	CLIP-seq
MIRT2524356	hsa-miR-3121-3p	CLIP-seq
MIRT2524357	hsa-miR-329	CLIP-seq
MIRT2524358	hsa-miR-3591-5p	CLIP-seq
MIRT2524359	hsa-miR-3606	CLIP-seq
MIRT2524360	hsa-miR-3607-5p	CLIP-seq
MIRT2524361	hsa-miR-3611	CLIP-seq
MIRT2524362	hsa-miR-3619-3p	CLIP-seq
MIRT2524363	hsa-miR-362-3p	CLIP-seq
MIRT2524364	hsa-miR-3647-3p	CLIP-seq
MIRT2524365	hsa-miR-3685	CLIP-seq
MIRT2524366	hsa-miR-3686	CLIP-seq
MIRT2524367	hsa-miR-381	CLIP-seq
MIRT2524368	hsa-miR-384	CLIP-seq
MIRT2524369	hsa-miR-3940-5p	CLIP-seq
MIRT2524370	hsa-miR-3977	CLIP-seq
MIRT2524371	hsa-miR-409-5p	CLIP-seq
MIRT2524372	hsa-miR-4259	CLIP-seq
MIRT2524373	hsa-miR-4305	CLIP-seq
MIRT2524374	hsa-miR-4471	CLIP-seq
MIRT2524375	hsa-miR-4477b	CLIP-seq
MIRT2524376	hsa-miR-4495	CLIP-seq
MIRT2524377	hsa-miR-4507	CLIP-seq
MIRT2524378	hsa-miR-4539	CLIP-seq
MIRT2524379	hsa-miR-4728-3p	CLIP-seq
MIRT2524380	hsa-miR-4729	CLIP-seq
MIRT2524381	hsa-miR-4775	CLIP-seq
MIRT2524382	hsa-miR-4776-5p	CLIP-seq
MIRT2524383	hsa-miR-4778-5p	CLIP-seq
MIRT2524384	hsa-miR-579	CLIP-seq
MIRT2524385	hsa-miR-582-5p	CLIP-seq
MIRT2524386	hsa-miR-586	CLIP-seq
MIRT2524387	hsa-miR-590-3p	CLIP-seq
MIRT2524388	hsa-miR-642b	CLIP-seq
MIRT2524389	hsa-miR-758	CLIP-seq
MIRT2524390	hsa-miR-760	CLIP-seq
MIRT2524391	hsa-miR-921	CLIP-seq
MIRT2524342	hsa-miR-1179	CLIP-seq
MIRT2524343	hsa-miR-1245	CLIP-seq
MIRT2524344	hsa-miR-1304	CLIP-seq
MIRT2524345	hsa-miR-141	CLIP-seq
MIRT2524346	hsa-miR-151-3p	CLIP-seq
MIRT2524347	hsa-miR-184	CLIP-seq
MIRT2524350	hsa-miR-200a	CLIP-seq
MIRT2524351	hsa-miR-2054	CLIP-seq
MIRT2524352	hsa-miR-2113	CLIP-seq
MIRT2524354	hsa-miR-223	CLIP-seq
MIRT2524355	hsa-miR-300	CLIP-seq
MIRT2524356	hsa-miR-3121-3p	CLIP-seq
MIRT2524357	hsa-miR-329	CLIP-seq
MIRT2524358	hsa-miR-3591-5p	CLIP-seq
MIRT2524359	hsa-miR-3606	CLIP-seq
MIRT2524361	hsa-miR-3611	CLIP-seq
MIRT2524362	hsa-miR-3619-3p	CLIP-seq
MIRT2524363	hsa-miR-362-3p	CLIP-seq
MIRT2524364	hsa-miR-3647-3p	CLIP-seq
MIRT2524365	hsa-miR-3685	CLIP-seq
MIRT2524366	hsa-miR-3686	CLIP-seq
MIRT2524367	hsa-miR-381	CLIP-seq
MIRT2524368	hsa-miR-384	CLIP-seq
MIRT2524369	hsa-miR-3940-5p	CLIP-seq
MIRT2524370	hsa-miR-3977	CLIP-seq
MIRT2524371	hsa-miR-409-5p	CLIP-seq
MIRT2524372	hsa-miR-4259	CLIP-seq
MIRT2524373	hsa-miR-4305	CLIP-seq
MIRT2524374	hsa-miR-4471	CLIP-seq
MIRT2524375	hsa-miR-4477b	CLIP-seq
MIRT2524376	hsa-miR-4495	CLIP-seq
MIRT2524377	hsa-miR-4507	CLIP-seq
MIRT2524378	hsa-miR-4539	CLIP-seq
MIRT2524379	hsa-miR-4728-3p	CLIP-seq
MIRT2524380	hsa-miR-4729	CLIP-seq
MIRT2524381	hsa-miR-4775	CLIP-seq
MIRT2524382	hsa-miR-4776-5p	CLIP-seq
MIRT2524383	hsa-miR-4778-5p	CLIP-seq
MIRT2524384	hsa-miR-579	CLIP-seq
MIRT2524385	hsa-miR-582-5p	CLIP-seq
MIRT2524386	hsa-miR-586	CLIP-seq
MIRT2524387	hsa-miR-590-3p	CLIP-seq
MIRT2524388	hsa-miR-642b	CLIP-seq
MIRT2524389	hsa-miR-758	CLIP-seq
MIRT2524390	hsa-miR-760	CLIP-seq
MIRT2524391	hsa-miR-921	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
ERG	Repression	20860828

Show/Hide all (40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002175	Process	Protein localization to paranode region of axon	ISS
GO:0003779	Function	Actin binding	IEA
GO:0005198	Function	Structural molecule activity	IEA
GO:0005200	Function	Structural constituent of cytoskeleton	TAS	21966409
GO:0005515	Function	Protein binding	IPI	12234973, 20936779, 24366813, 25416956, 32296183, 33961781, 36931259
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IBA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	9892180
GO:0005911	Component	Cell-cell junction	IDA	12234973
GO:0005929	Component	Cilium	IDA
GO:0006915	Process	Apoptotic process	IEA
GO:0008092	Function	Cytoskeletal protein binding	IEA
GO:0008150	Process	Biological_process	ND
GO:0008360	Process	Regulation of cell shape	ISS
GO:0016020	Component	Membrane	IEA
GO:0030054	Component	Cell junction	IDA
GO:0030673	Component	Axolemma	ISS
GO:0030865	Process	Cortical cytoskeleton organization	TAS	21966409
GO:0030866	Process	Cortical actin cytoskeleton organization	IEA
GO:0030913	Process	Paranodal junction assembly	ISS
GO:0031032	Process	Actomyosin structure organization	IBA
GO:0033270	Component	Paranode region of axon	IEA
GO:0033270	Component	Paranode region of axon	ISS
GO:0036064	Component	Ciliary basal body	IDA
GO:0043217	Process	Myelin maintenance	ISS
GO:0044224	Component	Juxtaparanode region of axon	ISS
GO:0048812	Process	Neuron projection morphogenesis	ISS
GO:0070161	Component	Anchoring junction	IEA
GO:0071205	Process	Protein localization to juxtaparanode region of axon	ISS
GO:0072659	Process	Protein localization to plasma membrane	ISS
GO:0098696	Process	Regulation of neurotransmitter receptor localization to postsynaptic specialization membrane	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0106006	Function	Cytoskeletal protein-membrane anchor activity	TAS	21966409

MIM	HGNC	e!Ensembl
605331	3380	ENSG00000082397

Q9Y2J2

Protein name

Band 4.1-like protein 3 (4.1B) (Differentially expressed in adenocarcinoma of the lung protein 1) (DAL-1) (Erythrocyte membrane protein band 4.1-like 3) [Cleaved into: Band 4.1-like protein 3, N-terminally processed]

Protein function

Tumor suppressor that inhibits cell proliferation and promotes apoptosis. Modulates the activity of protein arginine N-methyltransferases, including PRMT3 and PRMT5. {ECO:0000269|PubMed:15334060, ECO:0000269|PubMed:15737618, ECO:0000269|PubMed:1

PDB

2HE7 , 3BIN , 5RYM , 5RYN , 5RYO , 5RYP , 5RYQ , 5RYR , 5RYS , 5RYT , 5RYU , 5RYV , 5RYW , 5RYX , 5RYY , 5RYZ , 5RZ0 , 5RZ1 , 5RZ2 , 5RZ3 , 5RZ4 , 5RZ5 , 5RZ6 , 5RZ7 , 5RZ8 , 5RZ9 , 5RZA , 5RZB , 5RZC , 5RZD , 5RZE , 5RZF , 5RZG , 5RZH , 5RZI , 5RZJ , 5RZK , 5RZL , 5RZM , 5RZN , 5RZO , 5RZP , 5RZQ , 5RZR , 5RZS , 5RZT , 5RZU , 5RZV , 5RZW , 5RZX , 5RZY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09379	FERM_N	114 → 177	FERM N-terminal domain	Domain
PF00373	FERM_M	192 → 301	FERM central domain	Domain
PF09380	FERM_C	305 → 395	FERM C-terminal PH-like domain	Domain
PF08736	FA	398 → 441	FERM adjacent (FA)	Family
PF04382	SAB	717 → 765	SAB domain	Domain
PF05902	4_1_CTD	973 → 1079	4.1 protein C-terminal domain (CTD)	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed at high levels in brain, with lower levels in kidney, intestine, and testis. Detected in lung. {ECO:0000269|PubMed:9892180}.

Sequence

MTTESGSDSESKPDQEAEPQEAAGAQGRAGAPVPEPPKEEQQQALEQFAAAAAHSTPVRR
EVTDKEQEFAARAAKQLEYQQLEDDKLSQKSSSSKLSRSPLKIVKKPKSMQCKVILLDGS
EYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQVRSGAW
HFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDY
DPDECGSDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDL
HHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFE
STIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRTQAQTRRAS
ALIDRPAPYFERSSSKRYTMSRSLDGEVGTGQYATTKGISQTNLITTVTPEKKAEEERDE
EEDKRRKGEEVTPISAIRHEGKSPGLGTDSCPLSPPSTHCAPTSPTELRRRCKENDCKLP
GYEPSRAEHLPGEPALDSDGPGRPYLGDQDVAFSYRQQTGKGTTLFSFSLQLPESFPSLL
DDDGYLSFPNLSETNLLPQSLQHYLPIRSPSLVPCFLFIFFFLLSASFSVPYALTLSFPL
ALCLCYLEPKAASLSASLDNDPSDSSEEETDSERTDTAADGETTATESDQEEDAELKAQE
LEKTQDDLMKHQTNISELKRTFLETSTDTAVTNEWEKRLSTSPVRLAARQEDAPMIEPLV
PEETKQSSGEKLMDGSEIFSLLESARKPTEFIGGVTSTSQSWVQKMETKTESSGIETEPT
VHHLPLSTEKVVQETVLVEERRVVHASGDASYSAGDSGDAAAQPAFTGIKGKEGSALTEG
AKEEGGEEVAKAVLEQEETAAASRERQEEQSAAIHISETLEQKPHFESSTVKTETISFGS
VSPGGVKLEISTKEVPVVHTETKTITYESSQVDPGTDLEPGVLMSAQTITSETTSTTTTT
HITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIKEAKEQHPDMSVTKVVVHKETEI
TPEDGED

Sequence length

1087

Interactions

View interactions

	Reactome
			Neurexins and neuroligins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MUCOCUTANEOUS LYMPH NODE SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (75)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	15837747, 26222671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	10888600, 15116094, 15837747, 16142420, 19846932, 26300315, 29048640, 9892180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	Pubtator	14601094	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	31828581	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	37283758	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	10888600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	15731777	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17260099, 19846932		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	17260099		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	11996670	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	19846932	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	BEFREE	25609022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of uterine cervix	Cervical Intraepithelial Neoplasia	BEFREE	29679470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10888600, 12234973, 15837747, 16205641, 25609022, 26280082, 26300315, 29552220, 31545421, 9892180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	20651987	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	20651987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	23542458, 30005021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	36445533	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31828581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31828581	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33893082, 40001597	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16152585, 21544807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	12011257, 27637901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	LHGDN	15731777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25050929	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25621889	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	28009100	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	25830725	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	37373330	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28969024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	12234973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12234973, 15837747, 16205641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16152585, 17260099, 19846932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	17260099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10888600, 11996670, 12234973, 15837747, 16205641, 25609022, 26280082, 26300315, 29552220, 31545421, 9892180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of oropharynx	Malignant Neoplasm Of Oropharynx	BEFREE	31304592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	20651987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17280610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26923709, 30962003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23542458, 26300315, 26923709, 28500655, 29568917, 30962003, 31545421, 31734055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	17260099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12115567, 15138999, 16420693, 17260099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	15138999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	17260099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	17260099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	31171904	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	10888600, 11300722, 11996670, 12011257, 12478663, 15116094, 15674477, 15688033, 16142420, 16213361, 16707455, 20809251, 21529178, 31545421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	11996670	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	LHGDN	12478663, 16142420, 16213361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10888600, 11079777, 11996670, 15138999, 15837747, 16142420, 16152585, 16205641, 16213361, 17260099, 19115211, 21628394, 25050929, 25609022, 25621889 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	10888600, 16213361, 20809251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	10888600, 15138999, 15837747, 16128739, 16205641, 21526423, 22782504, 26280082, 29048640, 29568917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	31304592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	31304592, 35619332, 38286404	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	33323539	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	20651987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	20651987	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17280610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17280610	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18554153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20860828	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	19165527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	16205641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	26222671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	26916087, 29568917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32048621	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26923709, 30962003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	31828581	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34579655, 39354571	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	19115211		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	LHGDN	19115211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	30278442	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	24508839	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	31606044	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25830725, 28500655, 32368784, 32576279	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

EPB41L3 (erythrocyte membrane protein band 4.1 like 3)