Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	23135
Gene name	Lysine demethylase 6B
Gene symbol	KDM6B
Synonyms (NCBI Gene)	JMJD3NEDCFSANEDSST
Chromosome	17
Chromosome location	17p13.1
Summary	The protein encoded by this gene is a lysine-specific demethylase that specifically demethylates di- or tri-methylated lysine 27 of histone H3 (H3K27me2 or H3K27me3). H3K27 trimethylation is a repressive epigenetic mark controlling chromatin organization

Show/Hide all (2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs769566928	AGAG>-	Uncertain-significance, pathogenic	Frameshift variant, coding sequence variant
rs1597850788	AG>-	Uncertain-significance, pathogenic	Frameshift variant, coding sequence variant

506

Show/Hide all (506)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017568	hsa-miR-335-5p	Microarray	18185580
MIRT021179	hsa-miR-186-5p	Sequencing	20371350
MIRT027296	hsa-miR-101-3p	Sequencing	20371350
MIRT052574	hsa-let-7a-5p	CLASH	23622248
MIRT049017	hsa-miR-92a-3p	CLASH	23622248
MIRT040965	hsa-miR-18a-3p	CLASH	23622248
MIRT289587	hsa-miR-941	Luciferase reporter assayWestern blotImmunofluorescenceqRT-PCR	25049231
MIRT289587	hsa-miR-941	Luciferase reporter assayWestern blotImmunofluorescenceqRT-PCR	25049231
MIRT289587	hsa-miR-941	Luciferase reporter assayWestern blotImmunofluorescenceqRT-PCR	25049231
MIRT289587	hsa-miR-941	Luciferase reporter assayWestern blotImmunofluorescenceqRT-PCR	25049231
MIRT570662	hsa-miR-1296-3p	PAR-CLIP	20371350
MIRT570660	hsa-miR-7152-3p	PAR-CLIP	20371350
MIRT570659	hsa-miR-4481	PAR-CLIP	20371350
MIRT570658	hsa-miR-4745-5p	PAR-CLIP	20371350
MIRT570657	hsa-miR-4515	PAR-CLIP	20371350
MIRT570656	hsa-miR-3199	PAR-CLIP	20371350
MIRT570655	hsa-miR-8052	PAR-CLIP	20371350
MIRT570654	hsa-miR-4652-5p	PAR-CLIP	20371350
MIRT570653	hsa-miR-6795-5p	PAR-CLIP	20371350
MIRT570652	hsa-miR-6887-5p	PAR-CLIP	20371350
MIRT570651	hsa-miR-328-5p	PAR-CLIP	20371350
MIRT570650	hsa-miR-6885-5p	PAR-CLIP	20371350
MIRT570647	hsa-miR-4447	PAR-CLIP	20371350
MIRT570645	hsa-miR-4472	PAR-CLIP	20371350
MIRT570644	hsa-miR-7109-5p	PAR-CLIP	20371350
MIRT289579	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT289570	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT289577	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT289575	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT289583	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT289581	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT289573	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT289571	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT570662	hsa-miR-1296-3p	PAR-CLIP	20371350
MIRT570661	hsa-miR-6746-5p	PAR-CLIP	20371350
MIRT570660	hsa-miR-7152-3p	PAR-CLIP	20371350
MIRT570659	hsa-miR-4481	PAR-CLIP	20371350
MIRT570658	hsa-miR-4745-5p	PAR-CLIP	20371350
MIRT570657	hsa-miR-4515	PAR-CLIP	20371350
MIRT570656	hsa-miR-3199	PAR-CLIP	20371350
MIRT570655	hsa-miR-8052	PAR-CLIP	20371350
MIRT570654	hsa-miR-4652-5p	PAR-CLIP	20371350
MIRT570653	hsa-miR-6795-5p	PAR-CLIP	20371350
MIRT570652	hsa-miR-6887-5p	PAR-CLIP	20371350
MIRT570651	hsa-miR-328-5p	PAR-CLIP	20371350
MIRT570650	hsa-miR-6885-5p	PAR-CLIP	20371350
MIRT570649	hsa-miR-615-5p	PAR-CLIP	20371350
MIRT570648	hsa-miR-7704	PAR-CLIP	20371350
MIRT570647	hsa-miR-4447	PAR-CLIP	20371350
MIRT570645	hsa-miR-4472	PAR-CLIP	20371350
MIRT570646	hsa-miR-6771-5p	PAR-CLIP	20371350
MIRT570644	hsa-miR-7109-5p	PAR-CLIP	20371350
MIRT493423	hsa-miR-3940-3p	PAR-CLIP	23592263
MIRT493422	hsa-miR-4308	PAR-CLIP	23592263
MIRT493421	hsa-miR-4292	PAR-CLIP	23592263
MIRT493420	hsa-miR-6791-5p	PAR-CLIP	23592263
MIRT493419	hsa-miR-6777-5p	PAR-CLIP	23592263
MIRT493418	hsa-miR-6889-5p	PAR-CLIP	23592263
MIRT493417	hsa-miR-4746-5p	PAR-CLIP	23592263
MIRT493416	hsa-miR-2277-5p	PAR-CLIP	23592263
MIRT493415	hsa-miR-4706	PAR-CLIP	23592263
MIRT493414	hsa-miR-4749-5p	PAR-CLIP	23592263
MIRT493412	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT493413	hsa-miR-8085	PAR-CLIP	23592263
MIRT493411	hsa-miR-3178	PAR-CLIP	23592263
MIRT493410	hsa-miR-3175	PAR-CLIP	23592263
MIRT079165	hsa-miR-5787	PAR-CLIP	23592263
MIRT440397	hsa-miR-127-5p	HITS-CLIP	24374217
MIRT440397	hsa-miR-127-5p	HITS-CLIP	24374217
MIRT289587	hsa-miR-941	FlowqRT-PCRWestern blot	27755585
MIRT289575	hsa-miR-106a-5p	PAR-CLIP	26701625
MIRT289575	hsa-miR-106a-5p	PAR-CLIP	26701625
MIRT289577	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT289577	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT570662	hsa-miR-1296-3p	PAR-CLIP	26701625
MIRT570662	hsa-miR-1296-3p	PAR-CLIP	26701625
MIRT570662	hsa-miR-1296-3p	PAR-CLIP	26701625
MIRT289570	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT289570	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT289571	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT289571	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT289579	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT289579	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT493416	hsa-miR-2277-5p	PAR-CLIP	26701625
MIRT493416	hsa-miR-2277-5p	PAR-CLIP	26701625
MIRT493416	hsa-miR-2277-5p	PAR-CLIP	26701625
MIRT493416	hsa-miR-2277-5p	PAR-CLIP	26701625
MIRT493416	hsa-miR-2277-5p	PAR-CLIP	26701625
MIRT493410	hsa-miR-3175	PAR-CLIP	26701625
MIRT493410	hsa-miR-3175	PAR-CLIP	26701625
MIRT493410	hsa-miR-3175	PAR-CLIP	26701625
MIRT493410	hsa-miR-3175	PAR-CLIP	26701625
MIRT493410	hsa-miR-3175	PAR-CLIP	26701625
MIRT493411	hsa-miR-3178	PAR-CLIP	26701625
MIRT493411	hsa-miR-3178	PAR-CLIP	26701625
MIRT493411	hsa-miR-3178	PAR-CLIP	26701625
MIRT493411	hsa-miR-3178	PAR-CLIP	26701625
MIRT570656	hsa-miR-3199	PAR-CLIP	26701625
MIRT570656	hsa-miR-3199	PAR-CLIP	26701625
MIRT570656	hsa-miR-3199	PAR-CLIP	26701625
MIRT570651	hsa-miR-328-5p	PAR-CLIP	26701625
MIRT570651	hsa-miR-328-5p	PAR-CLIP	26701625
MIRT570651	hsa-miR-328-5p	PAR-CLIP	26701625
MIRT493423	hsa-miR-3940-3p	PAR-CLIP	26701625
MIRT493423	hsa-miR-3940-3p	PAR-CLIP	26701625
MIRT493423	hsa-miR-3940-3p	PAR-CLIP	26701625
MIRT493423	hsa-miR-3940-3p	PAR-CLIP	26701625
MIRT493423	hsa-miR-3940-3p	PAR-CLIP	26701625
MIRT493421	hsa-miR-4292	PAR-CLIP	26701625
MIRT493421	hsa-miR-4292	PAR-CLIP	26701625
MIRT493421	hsa-miR-4292	PAR-CLIP	26701625
MIRT493422	hsa-miR-4308	PAR-CLIP	26701625
MIRT493422	hsa-miR-4308	PAR-CLIP	26701625
MIRT493422	hsa-miR-4308	PAR-CLIP	26701625
MIRT570647	hsa-miR-4447	PAR-CLIP	26701625
MIRT570647	hsa-miR-4447	PAR-CLIP	26701625
MIRT570647	hsa-miR-4447	PAR-CLIP	26701625
MIRT570645	hsa-miR-4472	PAR-CLIP	26701625
MIRT570645	hsa-miR-4472	PAR-CLIP	26701625
MIRT570645	hsa-miR-4472	PAR-CLIP	26701625
MIRT570659	hsa-miR-4481	PAR-CLIP	26701625
MIRT570659	hsa-miR-4481	PAR-CLIP	26701625
MIRT570659	hsa-miR-4481	PAR-CLIP	26701625
MIRT570657	hsa-miR-4515	PAR-CLIP	26701625
MIRT570657	hsa-miR-4515	PAR-CLIP	26701625
MIRT570657	hsa-miR-4515	PAR-CLIP	26701625
MIRT570654	hsa-miR-4652-5p	PAR-CLIP	26701625
MIRT570654	hsa-miR-4652-5p	PAR-CLIP	26701625
MIRT570654	hsa-miR-4652-5p	PAR-CLIP	26701625
MIRT493415	hsa-miR-4706	PAR-CLIP	26701625
MIRT493415	hsa-miR-4706	PAR-CLIP	26701625
MIRT493415	hsa-miR-4706	PAR-CLIP	26701625
MIRT493415	hsa-miR-4706	PAR-CLIP	26701625
MIRT493415	hsa-miR-4706	PAR-CLIP	26701625
MIRT570658	hsa-miR-4745-5p	PAR-CLIP	26701625
MIRT570658	hsa-miR-4745-5p	PAR-CLIP	26701625
MIRT570658	hsa-miR-4745-5p	PAR-CLIP	26701625
MIRT493417	hsa-miR-4746-5p	PAR-CLIP	26701625
MIRT493417	hsa-miR-4746-5p	PAR-CLIP	26701625
MIRT493417	hsa-miR-4746-5p	PAR-CLIP	26701625
MIRT493417	hsa-miR-4746-5p	PAR-CLIP	26701625
MIRT493417	hsa-miR-4746-5p	PAR-CLIP	26701625
MIRT493414	hsa-miR-4749-5p	PAR-CLIP	26701625
MIRT493414	hsa-miR-4749-5p	PAR-CLIP	26701625
MIRT493414	hsa-miR-4749-5p	PAR-CLIP	26701625
MIRT493414	hsa-miR-4749-5p	PAR-CLIP	26701625
MIRT493414	hsa-miR-4749-5p	PAR-CLIP	26701625
MIRT289583	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT289583	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT289581	hsa-miR-526b-3p	PAR-CLIP	26701625
MIRT289581	hsa-miR-526b-3p	PAR-CLIP	26701625
MIRT079165	hsa-miR-5787	PAR-CLIP	26701625
MIRT079165	hsa-miR-5787	PAR-CLIP	26701625
MIRT079165	hsa-miR-5787	PAR-CLIP	26701625
MIRT079165	hsa-miR-5787	PAR-CLIP	26701625
MIRT079165	hsa-miR-5787	PAR-CLIP	26701625
MIRT493412	hsa-miR-6731-5p	PAR-CLIP	26701625
MIRT493412	hsa-miR-6731-5p	PAR-CLIP	26701625
MIRT493412	hsa-miR-6731-5p	PAR-CLIP	26701625
MIRT493412	hsa-miR-6731-5p	PAR-CLIP	26701625
MIRT493412	hsa-miR-6731-5p	PAR-CLIP	26701625
MIRT493419	hsa-miR-6777-5p	PAR-CLIP	26701625
MIRT493419	hsa-miR-6777-5p	PAR-CLIP	26701625
MIRT493419	hsa-miR-6777-5p	PAR-CLIP	26701625
MIRT493419	hsa-miR-6777-5p	PAR-CLIP	26701625
MIRT493419	hsa-miR-6777-5p	PAR-CLIP	26701625
MIRT493420	hsa-miR-6791-5p	PAR-CLIP	26701625
MIRT493420	hsa-miR-6791-5p	PAR-CLIP	26701625
MIRT493420	hsa-miR-6791-5p	PAR-CLIP	26701625
MIRT570653	hsa-miR-6795-5p	PAR-CLIP	26701625
MIRT570653	hsa-miR-6795-5p	PAR-CLIP	26701625
MIRT570653	hsa-miR-6795-5p	PAR-CLIP	26701625
MIRT570650	hsa-miR-6885-5p	PAR-CLIP	26701625
MIRT570650	hsa-miR-6885-5p	PAR-CLIP	26701625
MIRT570650	hsa-miR-6885-5p	PAR-CLIP	26701625
MIRT570652	hsa-miR-6887-5p	PAR-CLIP	26701625
MIRT570652	hsa-miR-6887-5p	PAR-CLIP	26701625
MIRT570652	hsa-miR-6887-5p	PAR-CLIP	26701625
MIRT493418	hsa-miR-6889-5p	PAR-CLIP	26701625
MIRT493418	hsa-miR-6889-5p	PAR-CLIP	26701625
MIRT493418	hsa-miR-6889-5p	PAR-CLIP	26701625
MIRT493418	hsa-miR-6889-5p	PAR-CLIP	26701625
MIRT493418	hsa-miR-6889-5p	PAR-CLIP	26701625
MIRT570644	hsa-miR-7109-5p	PAR-CLIP	26701625
MIRT570644	hsa-miR-7109-5p	PAR-CLIP	26701625
MIRT570644	hsa-miR-7109-5p	PAR-CLIP	26701625
MIRT570660	hsa-miR-7152-3p	PAR-CLIP	26701625
MIRT570660	hsa-miR-7152-3p	PAR-CLIP	26701625
MIRT570660	hsa-miR-7152-3p	PAR-CLIP	26701625
MIRT570660	hsa-miR-7152-3p	PAR-CLIP	26701625
MIRT570660	hsa-miR-7152-3p	PAR-CLIP	26701625
MIRT570660	hsa-miR-7152-3p	PAR-CLIP	26701625
MIRT570655	hsa-miR-8052	PAR-CLIP	26701625
MIRT570655	hsa-miR-8052	PAR-CLIP	26701625
MIRT570655	hsa-miR-8052	PAR-CLIP	26701625
MIRT493413	hsa-miR-8085	PAR-CLIP	26701625
MIRT493413	hsa-miR-8085	PAR-CLIP	26701625
MIRT493413	hsa-miR-8085	PAR-CLIP	26701625
MIRT493413	hsa-miR-8085	PAR-CLIP	26701625
MIRT493413	hsa-miR-8085	PAR-CLIP	26701625
MIRT289573	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT289573	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT289587	hsa-miR-941	PAR-CLIP	26701625
MIRT289587	hsa-miR-941	PAR-CLIP	26701625
MIRT027296	hsa-miR-101-3p	PAR-CLIP	27292025
MIRT493421	hsa-miR-4292	PAR-CLIP	27292025
MIRT079165	hsa-miR-5787	PAR-CLIP	27292025
MIRT493420	hsa-miR-6791-5p	PAR-CLIP	27292025
MIRT732810	hsa-miR-455-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blotting	33505218
MIRT570662	hsa-miR-1296-3p	PAR-CLIP	20371350
MIRT570660	hsa-miR-7152-3p	PAR-CLIP	20371350
MIRT570659	hsa-miR-4481	PAR-CLIP	20371350
MIRT570658	hsa-miR-4745-5p	PAR-CLIP	20371350
MIRT570657	hsa-miR-4515	PAR-CLIP	20371350
MIRT570656	hsa-miR-3199	PAR-CLIP	20371350
MIRT570655	hsa-miR-8052	PAR-CLIP	20371350
MIRT570654	hsa-miR-4652-5p	PAR-CLIP	20371350
MIRT570653	hsa-miR-6795-5p	PAR-CLIP	20371350
MIRT570652	hsa-miR-6887-5p	PAR-CLIP	20371350
MIRT570651	hsa-miR-328-5p	PAR-CLIP	20371350
MIRT570650	hsa-miR-6885-5p	PAR-CLIP	20371350
MIRT570647	hsa-miR-4447	PAR-CLIP	20371350
MIRT570645	hsa-miR-4472	PAR-CLIP	20371350
MIRT570644	hsa-miR-7109-5p	PAR-CLIP	20371350
MIRT289579	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT289570	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT289577	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT289575	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT289583	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT289581	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT289573	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT289571	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT570662	hsa-miR-1296-3p	PAR-CLIP	20371350
MIRT570661	hsa-miR-6746-5p	PAR-CLIP	20371350
MIRT570660	hsa-miR-7152-3p	PAR-CLIP	20371350
MIRT570659	hsa-miR-4481	PAR-CLIP	20371350
MIRT570658	hsa-miR-4745-5p	PAR-CLIP	20371350
MIRT570657	hsa-miR-4515	PAR-CLIP	20371350
MIRT570656	hsa-miR-3199	PAR-CLIP	20371350
MIRT570655	hsa-miR-8052	PAR-CLIP	20371350
MIRT570654	hsa-miR-4652-5p	PAR-CLIP	20371350
MIRT570653	hsa-miR-6795-5p	PAR-CLIP	20371350
MIRT570652	hsa-miR-6887-5p	PAR-CLIP	20371350
MIRT570651	hsa-miR-328-5p	PAR-CLIP	20371350
MIRT570650	hsa-miR-6885-5p	PAR-CLIP	20371350
MIRT570649	hsa-miR-615-5p	PAR-CLIP	20371350
MIRT570648	hsa-miR-7704	PAR-CLIP	20371350
MIRT570647	hsa-miR-4447	PAR-CLIP	20371350
MIRT570645	hsa-miR-4472	PAR-CLIP	20371350
MIRT570646	hsa-miR-6771-5p	PAR-CLIP	20371350
MIRT570644	hsa-miR-7109-5p	PAR-CLIP	20371350
MIRT493423	hsa-miR-3940-3p	PAR-CLIP	23592263
MIRT493422	hsa-miR-4308	PAR-CLIP	23592263
MIRT493421	hsa-miR-4292	PAR-CLIP	23592263
MIRT493420	hsa-miR-6791-5p	PAR-CLIP	23592263
MIRT493419	hsa-miR-6777-5p	PAR-CLIP	23592263
MIRT493418	hsa-miR-6889-5p	PAR-CLIP	23592263
MIRT493417	hsa-miR-4746-5p	PAR-CLIP	23592263
MIRT493416	hsa-miR-2277-5p	PAR-CLIP	23592263
MIRT493415	hsa-miR-4706	PAR-CLIP	23592263
MIRT493414	hsa-miR-4749-5p	PAR-CLIP	23592263
MIRT493412	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT493413	hsa-miR-8085	PAR-CLIP	23592263
MIRT493411	hsa-miR-3178	PAR-CLIP	23592263
MIRT493410	hsa-miR-3175	PAR-CLIP	23592263
MIRT079165	hsa-miR-5787	PAR-CLIP	23592263
MIRT289573	hsa-miR-93-5p	Luciferase reporter assayWestern blottingqRT-PCRCLIP-seq	38218880
MIRT1084947	hsa-miR-101	CLIP-seq
MIRT1084948	hsa-miR-1178	CLIP-seq
MIRT1084949	hsa-miR-1179	CLIP-seq
MIRT1084950	hsa-miR-1229	CLIP-seq
MIRT1084951	hsa-miR-1260	CLIP-seq
MIRT1084952	hsa-miR-1260b	CLIP-seq
MIRT1084953	hsa-miR-1275	CLIP-seq
MIRT1084954	hsa-miR-135a	CLIP-seq
MIRT1084955	hsa-miR-135b	CLIP-seq
MIRT1084956	hsa-miR-139-5p	CLIP-seq
MIRT1084957	hsa-miR-144	CLIP-seq
MIRT1084958	hsa-miR-146a	CLIP-seq
MIRT1084959	hsa-miR-148a	CLIP-seq
MIRT1084960	hsa-miR-148b	CLIP-seq
MIRT1084961	hsa-miR-152	CLIP-seq
MIRT1084962	hsa-miR-1538	CLIP-seq
MIRT1084963	hsa-miR-188-3p	CLIP-seq
MIRT1084964	hsa-miR-2392	CLIP-seq
MIRT1084965	hsa-miR-29a	CLIP-seq
MIRT1084966	hsa-miR-29b	CLIP-seq
MIRT1084967	hsa-miR-29c	CLIP-seq
MIRT1084968	hsa-miR-3121-3p	CLIP-seq
MIRT1084969	hsa-miR-3151	CLIP-seq
MIRT1084970	hsa-miR-3156-3p	CLIP-seq
MIRT1084971	hsa-miR-3173-3p	CLIP-seq
MIRT1084972	hsa-miR-3180	CLIP-seq
MIRT1084973	hsa-miR-3180-3p	CLIP-seq
MIRT1084974	hsa-miR-3181	CLIP-seq
MIRT1084975	hsa-miR-3184	CLIP-seq
MIRT1084976	hsa-miR-3196	CLIP-seq
MIRT1084977	hsa-miR-340	CLIP-seq
MIRT1084978	hsa-miR-342-3p	CLIP-seq
MIRT1084979	hsa-miR-3620	CLIP-seq
MIRT1084980	hsa-miR-3646	CLIP-seq
MIRT1084981	hsa-miR-3649	CLIP-seq
MIRT1084982	hsa-miR-3662	CLIP-seq
MIRT1084983	hsa-miR-3687	CLIP-seq
MIRT1084984	hsa-miR-3689a-3p	CLIP-seq
MIRT1084985	hsa-miR-3689c	CLIP-seq
MIRT1084986	hsa-miR-377	CLIP-seq
MIRT1084987	hsa-miR-3919	CLIP-seq
MIRT1084988	hsa-miR-3934	CLIP-seq
MIRT1084989	hsa-miR-4254	CLIP-seq
MIRT1084990	hsa-miR-4277	CLIP-seq
MIRT1084991	hsa-miR-4301	CLIP-seq
MIRT1084992	hsa-miR-4323	CLIP-seq
MIRT1084993	hsa-miR-4433	CLIP-seq
MIRT1084994	hsa-miR-4442	CLIP-seq
MIRT1084995	hsa-miR-4446-5p	CLIP-seq
MIRT1084996	hsa-miR-4455	CLIP-seq
MIRT1084997	hsa-miR-4497	CLIP-seq
MIRT1084998	hsa-miR-4645-5p	CLIP-seq
MIRT1084999	hsa-miR-4648	CLIP-seq
MIRT1085000	hsa-miR-4654	CLIP-seq
MIRT1085001	hsa-miR-4665-5p	CLIP-seq
MIRT1085002	hsa-miR-4673	CLIP-seq
MIRT1085003	hsa-miR-4690-3p	CLIP-seq
MIRT1085004	hsa-miR-4723-5p	CLIP-seq
MIRT1085005	hsa-miR-4745-3p	CLIP-seq
MIRT1085006	hsa-miR-4758-5p	CLIP-seq
MIRT1085007	hsa-miR-4769-5p	CLIP-seq
MIRT1085008	hsa-miR-4778-3p	CLIP-seq
MIRT1085009	hsa-miR-548c-3p	CLIP-seq
MIRT1085010	hsa-miR-589	CLIP-seq
MIRT1085011	hsa-miR-603	CLIP-seq
MIRT1085012	hsa-miR-621	CLIP-seq
MIRT1085013	hsa-miR-675	CLIP-seq
MIRT1084947	hsa-miR-101	CLIP-seq
MIRT1084948	hsa-miR-1178	CLIP-seq
MIRT1084949	hsa-miR-1179	CLIP-seq
MIRT2021617	hsa-miR-1238	CLIP-seq
MIRT1084953	hsa-miR-1275	CLIP-seq
MIRT2021618	hsa-miR-1276	CLIP-seq
MIRT1084954	hsa-miR-135a	CLIP-seq
MIRT1084955	hsa-miR-135b	CLIP-seq
MIRT2021619	hsa-miR-138	CLIP-seq
MIRT1084956	hsa-miR-139-5p	CLIP-seq
MIRT1084957	hsa-miR-144	CLIP-seq
MIRT2021620	hsa-miR-150	CLIP-seq
MIRT1084962	hsa-miR-1538	CLIP-seq
MIRT1084964	hsa-miR-2392	CLIP-seq
MIRT1084969	hsa-miR-3151	CLIP-seq
MIRT1084971	hsa-miR-3173-3p	CLIP-seq
MIRT1084974	hsa-miR-3181	CLIP-seq
MIRT1084975	hsa-miR-3184	CLIP-seq
MIRT2021621	hsa-miR-3197	CLIP-seq
MIRT1084979	hsa-miR-3620	CLIP-seq
MIRT1084982	hsa-miR-3662	CLIP-seq
MIRT1084983	hsa-miR-3687	CLIP-seq
MIRT1084984	hsa-miR-3689a-3p	CLIP-seq
MIRT1084985	hsa-miR-3689c	CLIP-seq
MIRT2021622	hsa-miR-3926	CLIP-seq
MIRT1084988	hsa-miR-3934	CLIP-seq
MIRT2021623	hsa-miR-4311	CLIP-seq
MIRT1084992	hsa-miR-4323	CLIP-seq
MIRT1084993	hsa-miR-4433	CLIP-seq
MIRT1084994	hsa-miR-4442	CLIP-seq
MIRT1084995	hsa-miR-4446-5p	CLIP-seq
MIRT1084996	hsa-miR-4455	CLIP-seq
MIRT2021624	hsa-miR-4456	CLIP-seq
MIRT1084997	hsa-miR-4497	CLIP-seq
MIRT1084999	hsa-miR-4648	CLIP-seq
MIRT2021625	hsa-miR-4649-5p	CLIP-seq
MIRT1085000	hsa-miR-4654	CLIP-seq
MIRT1085001	hsa-miR-4665-5p	CLIP-seq
MIRT2021626	hsa-miR-4710	CLIP-seq
MIRT2021627	hsa-miR-4713-5p	CLIP-seq
MIRT1085004	hsa-miR-4723-5p	CLIP-seq
MIRT1085005	hsa-miR-4745-3p	CLIP-seq
MIRT2021628	hsa-miR-4747-5p	CLIP-seq
MIRT2021629	hsa-miR-4753-5p	CLIP-seq
MIRT1085007	hsa-miR-4769-5p	CLIP-seq
MIRT2021630	hsa-miR-532-3p	CLIP-seq
MIRT2021631	hsa-miR-541	CLIP-seq
MIRT2021632	hsa-miR-583	CLIP-seq
MIRT2021633	hsa-miR-599	CLIP-seq
MIRT1085011	hsa-miR-603	CLIP-seq
MIRT1085012	hsa-miR-621	CLIP-seq
MIRT2021634	hsa-miR-654-5p	CLIP-seq
MIRT1084947	hsa-miR-101	CLIP-seq
MIRT2253123	hsa-miR-106a	CLIP-seq
MIRT2253124	hsa-miR-106b	CLIP-seq
MIRT1084948	hsa-miR-1178	CLIP-seq
MIRT1084949	hsa-miR-1179	CLIP-seq
MIRT2253125	hsa-miR-1207-5p	CLIP-seq
MIRT1084951	hsa-miR-1260	CLIP-seq
MIRT1084952	hsa-miR-1260b	CLIP-seq
MIRT2021618	hsa-miR-1276	CLIP-seq
MIRT1084956	hsa-miR-139-5p	CLIP-seq
MIRT1084957	hsa-miR-144	CLIP-seq
MIRT1084958	hsa-miR-146a	CLIP-seq
MIRT1084959	hsa-miR-148a	CLIP-seq
MIRT1084960	hsa-miR-148b	CLIP-seq
MIRT1084961	hsa-miR-152	CLIP-seq
MIRT1084962	hsa-miR-1538	CLIP-seq
MIRT2253126	hsa-miR-17	CLIP-seq
MIRT1084963	hsa-miR-188-3p	CLIP-seq
MIRT2253127	hsa-miR-20a	CLIP-seq
MIRT2253128	hsa-miR-20b	CLIP-seq
MIRT2253129	hsa-miR-296-3p	CLIP-seq
MIRT1084965	hsa-miR-29a	CLIP-seq
MIRT1084966	hsa-miR-29b	CLIP-seq
MIRT1084967	hsa-miR-29c	CLIP-seq
MIRT2253130	hsa-miR-3065-5p	CLIP-seq
MIRT2253131	hsa-miR-30a	CLIP-seq
MIRT2253132	hsa-miR-30b	CLIP-seq
MIRT2253133	hsa-miR-30c	CLIP-seq
MIRT2253134	hsa-miR-30d	CLIP-seq
MIRT2253135	hsa-miR-30e	CLIP-seq
MIRT1084969	hsa-miR-3151	CLIP-seq
MIRT1084970	hsa-miR-3156-3p	CLIP-seq
MIRT1084974	hsa-miR-3181	CLIP-seq
MIRT1084975	hsa-miR-3184	CLIP-seq
MIRT2253136	hsa-miR-3607-3p	CLIP-seq
MIRT1084979	hsa-miR-3620	CLIP-seq
MIRT1084983	hsa-miR-3687	CLIP-seq
MIRT1084986	hsa-miR-377	CLIP-seq
MIRT1084990	hsa-miR-4277	CLIP-seq
MIRT1084991	hsa-miR-4301	CLIP-seq
MIRT2021623	hsa-miR-4311	CLIP-seq
MIRT1084993	hsa-miR-4433	CLIP-seq
MIRT1084994	hsa-miR-4442	CLIP-seq
MIRT2253137	hsa-miR-4651	CLIP-seq
MIRT2021626	hsa-miR-4710	CLIP-seq
MIRT2253138	hsa-miR-4736	CLIP-seq
MIRT1085005	hsa-miR-4745-3p	CLIP-seq
MIRT2253139	hsa-miR-4763-3p	CLIP-seq
MIRT1085008	hsa-miR-4778-3p	CLIP-seq
MIRT2253140	hsa-miR-493	CLIP-seq
MIRT2253141	hsa-miR-517b	CLIP-seq
MIRT2253142	hsa-miR-519a	CLIP-seq
MIRT2253143	hsa-miR-519d	CLIP-seq
MIRT2253144	hsa-miR-548ad	CLIP-seq
MIRT1085009	hsa-miR-548c-3p	CLIP-seq
MIRT2253145	hsa-miR-561	CLIP-seq
MIRT2021632	hsa-miR-583	CLIP-seq
MIRT1085010	hsa-miR-589	CLIP-seq
MIRT2253146	hsa-miR-608	CLIP-seq
MIRT1085012	hsa-miR-621	CLIP-seq
MIRT1085013	hsa-miR-675	CLIP-seq
MIRT2253147	hsa-miR-93	CLIP-seq
MIRT2253148	hsa-miR-939	CLIP-seq
MIRT1084949	hsa-miR-1179	CLIP-seq
MIRT2021618	hsa-miR-1276	CLIP-seq
MIRT1084958	hsa-miR-146a	CLIP-seq
MIRT1084965	hsa-miR-29a	CLIP-seq
MIRT1084966	hsa-miR-29b	CLIP-seq
MIRT1084967	hsa-miR-29c	CLIP-seq
MIRT2021623	hsa-miR-4311	CLIP-seq
MIRT2021632	hsa-miR-583	CLIP-seq
MIRT1085010	hsa-miR-589	CLIP-seq
MIRT1085012	hsa-miR-621	CLIP-seq
MIRT2253148	hsa-miR-939	CLIP-seq
MIRT2253129	hsa-miR-296-3p	CLIP-seq
MIRT2430256	hsa-miR-3667-5p	CLIP-seq
MIRT1084986	hsa-miR-377	CLIP-seq
MIRT2430257	hsa-miR-4425	CLIP-seq
MIRT2021628	hsa-miR-4747-5p	CLIP-seq
MIRT1085009	hsa-miR-548c-3p	CLIP-seq
MIRT2430258	hsa-miR-7	CLIP-seq
MIRT1084958	hsa-miR-146a	CLIP-seq
MIRT1084962	hsa-miR-1538	CLIP-seq
MIRT2253129	hsa-miR-296-3p	CLIP-seq
MIRT1084965	hsa-miR-29a	CLIP-seq
MIRT1084966	hsa-miR-29b	CLIP-seq
MIRT1084967	hsa-miR-29c	CLIP-seq
MIRT1084972	hsa-miR-3180	CLIP-seq
MIRT1084973	hsa-miR-3180-3p	CLIP-seq
MIRT1084974	hsa-miR-3181	CLIP-seq
MIRT1084976	hsa-miR-3196	CLIP-seq
MIRT2430256	hsa-miR-3667-5p	CLIP-seq
MIRT1084983	hsa-miR-3687	CLIP-seq
MIRT1084986	hsa-miR-377	CLIP-seq
MIRT2430257	hsa-miR-4425	CLIP-seq
MIRT1084994	hsa-miR-4442	CLIP-seq
MIRT1085005	hsa-miR-4745-3p	CLIP-seq
MIRT2021628	hsa-miR-4747-5p	CLIP-seq
MIRT1085009	hsa-miR-548c-3p	CLIP-seq
MIRT1085010	hsa-miR-589	CLIP-seq
MIRT2021633	hsa-miR-599	CLIP-seq
MIRT1085011	hsa-miR-603	CLIP-seq
MIRT2430258	hsa-miR-7	CLIP-seq
MIRT2253148	hsa-miR-939	CLIP-seq
MIRT2253129	hsa-miR-296-3p	CLIP-seq
MIRT1084986	hsa-miR-377	CLIP-seq
MIRT1085009	hsa-miR-548c-3p	CLIP-seq
MIRT1084959	hsa-miR-148a	CLIP-seq
MIRT1084960	hsa-miR-148b	CLIP-seq
MIRT1084961	hsa-miR-152	CLIP-seq
MIRT2253129	hsa-miR-296-3p	CLIP-seq
MIRT2430256	hsa-miR-3667-5p	CLIP-seq
MIRT1084986	hsa-miR-377	CLIP-seq
MIRT2430257	hsa-miR-4425	CLIP-seq
MIRT2021628	hsa-miR-4747-5p	CLIP-seq
MIRT1085009	hsa-miR-548c-3p	CLIP-seq
MIRT2021633	hsa-miR-599	CLIP-seq
MIRT1085013	hsa-miR-675	CLIP-seq
MIRT2430258	hsa-miR-7	CLIP-seq
MIRT2021633	hsa-miR-599	CLIP-seq

Show/Hide all (41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0002437	Process	Inflammatory response to antigenic stimulus	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0005515	Function	Protein binding	IPI	21841772
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS	23856522
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006338	Process	Chromatin remodeling	ISS
GO:0006954	Process	Inflammatory response	IEA
GO:0007507	Process	Heart development	IBA
GO:0008013	Function	Beta-catenin binding	IEA
GO:0010468	Process	Regulation of gene expression	IBA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0014823	Process	Response to activity	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0021766	Process	Hippocampus development	IEA
GO:0031490	Function	Chromatin DNA binding	IBA
GO:0032452	Function	Histone demethylase activity	TAS
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0044666	Component	MLL3/4 complex	IBA
GO:0045165	Process	Cell fate commitment	IEA
GO:0045446	Process	Endothelial cell differentiation	IEA
GO:0045446	Process	Endothelial cell differentiation	ISS	23856522
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS	23856522
GO:0046872	Function	Metal ion binding	IEA
GO:0048333	Process	Mesodermal cell differentiation	IEA
GO:0048333	Process	Mesodermal cell differentiation	ISS	23856522
GO:0051213	Function	Dioxygenase activity	IEA
GO:0055007	Process	Cardiac muscle cell differentiation	IEA
GO:0055007	Process	Cardiac muscle cell differentiation	ISS	23856522
GO:0060992	Process	Response to fungicide	IEA
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0071558	Function	Histone H3K27me2/H3K27me3 demethylase activity	IBA
GO:0071558	Function	Histone H3K27me2/H3K27me3 demethylase activity	IEA
GO:0071558	Function	Histone H3K27me2/H3K27me3 demethylase activity	IMP	28262558
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	26625958

MIM	HGNC	e!Ensembl
611577	29012	ENSG00000132510

O15054

Protein name

Lysine-specific demethylase 6B (EC 1.14.11.68) (JmjC domain-containing protein 3) (Jumonji domain-containing protein 3) (Lysine demethylase 6B) ([histone H3]-trimethyl-L-lysine(27) demethylase 6B)

Protein function

Histone demethylase that specifically demethylates 'Lys-27' of histone H3, thereby playing a central role in histone code (PubMed:17713478, PubMed:17825402, PubMed:17851529, PubMed:18003914). Demethylates trimethylated and dimethylated H3 'Lys-2

PDB

2XUE , 2XXZ , 4ASK , 5FP3 , 5OY3 , 6F6D

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02373	JmjC	1377 → 1485	JmjC domain, hydroxylase	Domain

Sequence

MHRAVDPPGARAAREAFALGGLSCAGAWSSCPPHPPPRSAWLPGGRCSASIGQPPLPAPL
PPSHGSSSGHPSKPYYAPGAPTPRPLHGKLESLHGCVQALLREPAQPGLWEQLGQLYESE
HDSEEATRCYHSALRYGGSFAELGPRIGRLQQAQLWNFHTGSCQHRAKVLPPLEQVWNLL
HLEHKRNYGAKRGGPPVKRAAEPPVVQPVPPAALSGPSGEEGLSPGGKRRRGCNSEQTGL
PPGLPLPPPPLPPPPPPPPPPPPPLPGLATSPPFQLTKPGLWSTLHGDAWGPERKGSAPP
ERQEQRHSLPHPYPYPAPAYTAHPPGHRLVPAAPPGPGPRPPGAESHGCLPATRPPGSDL
RESRVQRSRMDSSVSPAATTACVPYAPSRPPGLPGTTTSSSSSSSSNTGLRGVEPNPGIP
GADHYQTPALEVSHHGRLGPSAHSSRKPFLGAPAATPHLSLPPGPSSPPPPPCPRLLRPP
PPPAWLKGPACRAAREDGEILEELFFGTEGPPRPAPPPLPHREGFLGPPASRFSVGTQDS
HTPPTPPTPTTSSSNSNSGSHSSSPAGPVSFPPPPYLARSIDPLPRPPSPAQNPQDPPLV
PLTLALPPAPPSSCHQNTSGSFRRPESPRPRVSFPKTPEVGPGPPPGPLSKAPQPVPPGV
GELPARGPRLFDFPPTPLEDQFEEPAEFKILPDGLANIMKMLDESIRKEEEQQQHEAGVA
PQPPLKEPFASLQSPFPTDTAPTTTAPAVAVTTTTTTTTTTTATQEEEKKPPPALPPPPP
LAKFPPPSQPQPPPPPPPSPASLLKSLASVLEGQKYCYRGTGAAVSTRPGPLPTTQYSPG
PPSGATALPPTSAAPSAQGSPQPSASSSSQFSTSGGPWARERRAGEEPVPGPMTPTQPPP
PLSLPPARSESEVLEEISRACETLVERVGRSATDPADPVDTAEPADSGTERLLPPAQAKE
EAGGVAAVSGSCKRRQKEHQKEHRRHRRACKDSVGRRPREGRAKAKAKVPKEKSRRVLGN
LDLQSEEIQGREKSRPDLGGASKAKPPTAPAPPSAPAPSAQPTPPSASVPGKKAREEAPG
PPGVSRADMLKLRSLSEGPPKELKIRLIKVESGDKETFIASEVEERRLRMADLTISHCAA
DVVRASRNAKVKGKFRESYLSPAQSVKPKINTEEKLPREKLNPPTPSIYLESKRDAFSPV
LLQFCTDPRNPITVIRGLAGSLRLNLGLFSTKTLVEASGEHTVEVRTQVQQPSDENWDLT
GTRQIWPCESSRSHTTIAKYAQYQASSFQESLQEEKESEDEESEEPDSTTGTPPSSAPDP
KNHHIIKFGTNIDLSDAKRWKPQLQELLKLPAFMRVTSTGNMLSHVGHTILGMNTVQLYM
KVPGSRTPGHQENNNFCSVNINIGPGDCEWFAVHEHYWETISAFCDRHGVDYLTGSWWPI
LDDLYASNIPVYRFVQRPGDLVWINAGTVHWVQATGWCNNIAWNVGPLTAYQYQLALERY
EWNEVKNVKSIVPMIHVSWNVARTVKISDPDLFKMIKFCLLQSMKHCQVQRESLVRAGKK
IAYQGRVKDEPAYYCNECDVEVFNILFVTSENGSRNTYLVHCEGCARRRSAGLQGVVVLE
QYRTEELAQAYDAFTLAPASTSR

Sequence length

1643

Interactions

View interactions

	Reactome
			Oxidative Stress Induced Senescence HDMs demethylate histones

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (6)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Intellectual disability	Likely pathogenic; Pathogenic	rs2544521866	RCV005626626	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
KDM6B-related disorder	Likely pathogenic	rs1294523865, rs2544524865, rs988670906, rs2544526628	RCV004749834 RCV005250241 RCV003403022 RCV003894683	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Malignant tumor of urinary bladder	Likely pathogenic	rs2078522713	RCV005930259	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental abnormality	Pathogenic	rs957520585	RCV001264704	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental delay	Likely pathogenic; Pathogenic	rs1597842212	RCV002274351	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental disorder with coarse facies and mild distal skeletal abnormalities	Pathogenic; Likely pathogenic	rs59062945, rs2151375529, rs2078638223, rs2151379742, rs2151379880, rs1294523865, rs2151380462, rs2151379290, rs2151376850, rs2151378140, rs2078539742, rs1597842212, rs1311274985, rs761401181, rs2544536378 View all (62 more)	RCV001420566 RCV001775402 RCV003150459 RCV001827593 RCV002071025 View all (73 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, ADENOID CYSTIC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEVELOPMENTAL DISABILITIES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Developmental disorder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KDM6B-related neurodevelopmental disorder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL RETARDATION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOBIUS SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oromandibular-limb hypogenesis spectrum	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (159)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	30135572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	CTD_human_DG	23685749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	27102442, 27742770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	21242977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	28554742, 29108280		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	24947179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	30827484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	30827484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Apraxia of Phonation	Apraxia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28189690, 29908485		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28189690, 29908485		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	33155823, 36251081	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	36251081	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic behavior	Autism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	27983522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28423536, 29925528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21841772, 33962648, 37223020	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35254477, 36564369	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25049231, 35254477	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	34399838	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	27983522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23057811, 26261509, 28177890	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	27983522	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28849826, 29422491, 30277596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	34667186	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	35831280	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	28554742, 29108280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	31241814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Class III malocclusion	Malocclusion	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Clinodactyly of the 5th finger	Camptodactyly of fingers	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	33362389	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	21890490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	21890490	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26416711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21890490	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Epicanthus	Congenital Epicanthus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital pectus excavatum	Congenital Pectus Excavatum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23057811, 26261509, 27983522, 28789379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	31102789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28314754, 29622035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30364220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	36251081	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes	Diabetes	BEFREE	29227285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29227285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	32210958	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Intrinsic Pontine Glioma	Diffuse Intrinsic Pontine Glioma	BEFREE	25473916, 31238504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	27102442, 27742770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	BEFREE	31124279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	30896884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	30277596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	33318475	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esotropia	Esotropia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Exotropia	Exotropia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23236496, 28384648, 31238504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	28384648	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23236496, 28384648, 31238504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25652587, 30633952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25652587	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	31124279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	33155823	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	27755585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	20714105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	30936419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	30936419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	21242977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	34667186	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoplasia of nipple	Hypoplasia Of Nipple	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	25351418	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	33318475	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35930654	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	31701394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	CTD_human_DG	21937992		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	37286519	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	24947179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	29227285		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	22252741, 30135572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	29224413, 29477140	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	29224413	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29594337, 30135572, 30936419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	30275007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27651311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	28430662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	28430662, 36213329	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	28430662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	22014533, 28430662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	28430662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26261509	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31155967	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	31210309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31210309	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrostomia	Macrostomia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrotia	Macrotia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	25652587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28423536, 29925528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	30896884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	25427687, 29245970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28849826, 29422491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	24947179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17923864, 29805743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30374835, 30696880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	27983522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21242977, 23057811, 25652587, 26957416, 27651311, 28188179, 29925528, 30633952, 30696880, 31545292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	28554742, 29108280		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	26729791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningomyelocele	Meningomyelocele	BEFREE	23971635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental deficiency	Mental retardation	CTD_human_DG	21937992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30364220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	27529370	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Bone Disorder	Metabolic Bone Disorder	BEFREE	22770241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	17923864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	28487543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	28487543	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	30389724		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	23538751, 30275007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	23538751	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22020331, 23236496, 24046371, 24947179, 25593028, 25652587, 26729791, 27102442, 27983522, 29769286, 30631055, 30896884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	29769286, 30631055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	34893606	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	31124279		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26303949, 31155967, 31210309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29911994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	27388528, 35831280	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	33546766	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	22770241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30651137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	28849826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28849826, 29422491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26864203, 28849826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	24947179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	24212761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	32210958	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	30936419, 31001470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Profound Mental Retardation	Mental retardation	CTD_human_DG	21937992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17923864, 29805743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17923864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	37840069	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	25427687, 29245970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23057811, 27983522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	29227285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis pigmentosa	Pubtator	33546766	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	29481307, 29844591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29621735, 30337925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	29757189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30678869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25275298, 35855897	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	25275298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30374835, 30696880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30696880	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36564369	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	31779639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	29070530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	27983522	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	37658535	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	21245294	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	25593028	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	29982434		★★★★★ ★☆☆☆☆ Found in Text Mining only

KDM6B (lysine demethylase 6B)