PLXND1 (plexin D1)

Gene

• Entrez ID: 23129
• Gene name: Plexin D1
• Gene symbol: PLXND1
• Synonyms (NCBI Gene): CHTD9, PLEXD1
• Chromosome: 3
• Chromosome location: 3q22.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001523	hsa-miR-155-5p	pSILAC	18668040
MIRT017498	hsa-miR-335-5p	Microarray	18185580
MIRT001523	hsa-miR-155-5p	Proteomics;Other	18668040
MIRT045997	hsa-miR-125b-5p	CLASH	23622248
MIRT040538	hsa-miR-92b-3p	CLASH	23622248
MIRT470867	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT470866	hsa-miR-4500	PAR-CLIP	23592263
MIRT470865	hsa-miR-4458	PAR-CLIP	23592263
MIRT470864	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT470863	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT470862	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT470861	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT470860	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT470859	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT470858	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT470857	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT470856	hsa-miR-3927-3p	PAR-CLIP	23592263
MIRT470855	hsa-miR-6831-5p	PAR-CLIP	23592263
MIRT470853	hsa-miR-4302	PAR-CLIP	23592263
MIRT470854	hsa-miR-199a-5p	PAR-CLIP	23592263
MIRT470852	hsa-miR-199b-5p	PAR-CLIP	23592263
MIRT470851	hsa-miR-3130-3p	PAR-CLIP	23592263
MIRT470849	hsa-miR-1285-3p	PAR-CLIP	23592263
MIRT470848	hsa-miR-3187-5p	PAR-CLIP	23592263
MIRT470847	hsa-miR-5189-5p	PAR-CLIP	23592263
MIRT470846	hsa-miR-612	PAR-CLIP	23592263
MIRT470844	hsa-miR-6860	PAR-CLIP	23592263
MIRT470845	hsa-miR-4486	PAR-CLIP	23592263
MIRT470843	hsa-miR-378g	PAR-CLIP	23592263
MIRT470842	hsa-miR-202-3p	PAR-CLIP	23592263
MIRT470841	hsa-miR-767-5p	PAR-CLIP	23592263
MIRT470840	hsa-miR-6744-5p	PAR-CLIP	23592263
MIRT470839	hsa-miR-1255a	PAR-CLIP	23592263
MIRT470838	hsa-miR-1255b-5p	PAR-CLIP	23592263
MIRT470829	hsa-miR-4451	PAR-CLIP	23592263
MIRT470828	hsa-miR-376b-5p	PAR-CLIP	23592263
MIRT470827	hsa-miR-376c-5p	PAR-CLIP	23592263
MIRT470826	hsa-miR-3691-5p	PAR-CLIP	23592263
MIRT470825	hsa-miR-8056	PAR-CLIP	23592263
MIRT470824	hsa-miR-3911	PAR-CLIP	23592263
MIRT470823	hsa-miR-4314	PAR-CLIP	23592263
MIRT470819	hsa-miR-4752	PAR-CLIP	23592263
MIRT470892	hsa-miR-552-3p	PAR-CLIP	23592263
MIRT470891	hsa-miR-4802-5p	PAR-CLIP	23592263
MIRT470890	hsa-miR-4534	PAR-CLIP	23592263
MIRT470889	hsa-miR-8082	PAR-CLIP	23592263
MIRT470888	hsa-miR-3689d	PAR-CLIP	23592263
MIRT470887	hsa-miR-6851-5p	PAR-CLIP	23592263
MIRT470886	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT470885	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT470883	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT470884	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT470882	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT470881	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT470880	hsa-miR-3144-5p	PAR-CLIP	23592263
MIRT470879	hsa-miR-3191-3p	PAR-CLIP	23592263
MIRT470878	hsa-miR-4652-5p	PAR-CLIP	23592263
MIRT470877	hsa-miR-1233-5p	PAR-CLIP	23592263
MIRT470876	hsa-miR-6778-5p	PAR-CLIP	23592263
MIRT470875	hsa-miR-1273h-5p	PAR-CLIP	23592263
MIRT470874	hsa-miR-30b-3p	PAR-CLIP	23592263
MIRT470873	hsa-miR-3689a-3p	PAR-CLIP	23592263
MIRT470872	hsa-miR-3689b-3p	PAR-CLIP	23592263
MIRT470870	hsa-miR-3689c	PAR-CLIP	23592263
MIRT470871	hsa-miR-6779-5p	PAR-CLIP	23592263
MIRT470869	hsa-miR-6780a-5p	PAR-CLIP	23592263
MIRT470868	hsa-miR-6810-5p	PAR-CLIP	23592263
MIRT470867	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT470866	hsa-miR-4500	PAR-CLIP	23592263
MIRT470865	hsa-miR-4458	PAR-CLIP	23592263
MIRT470864	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT470863	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT470862	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT470861	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT470860	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT470859	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT470858	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT470857	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT470856	hsa-miR-3927-3p	PAR-CLIP	23592263
MIRT470855	hsa-miR-6831-5p	PAR-CLIP	23592263
MIRT470853	hsa-miR-4302	PAR-CLIP	23592263
MIRT470854	hsa-miR-199a-5p	PAR-CLIP	23592263
MIRT470852	hsa-miR-199b-5p	PAR-CLIP	23592263
MIRT470851	hsa-miR-3130-3p	PAR-CLIP	23592263
MIRT470850	hsa-miR-1184	PAR-CLIP	23592263
MIRT470849	hsa-miR-1285-3p	PAR-CLIP	23592263
MIRT470848	hsa-miR-3187-5p	PAR-CLIP	23592263
MIRT470847	hsa-miR-5189-5p	PAR-CLIP	23592263
MIRT470846	hsa-miR-612	PAR-CLIP	23592263
MIRT470844	hsa-miR-6860	PAR-CLIP	23592263
MIRT470845	hsa-miR-4486	PAR-CLIP	23592263
MIRT470843	hsa-miR-378g	PAR-CLIP	23592263
MIRT470842	hsa-miR-202-3p	PAR-CLIP	23592263
MIRT470841	hsa-miR-767-5p	PAR-CLIP	23592263
MIRT470840	hsa-miR-6744-5p	PAR-CLIP	23592263
MIRT470839	hsa-miR-1255a	PAR-CLIP	23592263
MIRT470838	hsa-miR-1255b-5p	PAR-CLIP	23592263
MIRT470837	hsa-miR-4656	PAR-CLIP	23592263
MIRT470836	hsa-miR-6829-5p	PAR-CLIP	23592263
MIRT470834	hsa-miR-4492	PAR-CLIP	23592263
MIRT470835	hsa-miR-4498	PAR-CLIP	23592263
MIRT470833	hsa-miR-5001-5p	PAR-CLIP	23592263
MIRT470832	hsa-miR-762	PAR-CLIP	23592263
MIRT470831	hsa-miR-4675	PAR-CLIP	23592263
MIRT470830	hsa-miR-4741	PAR-CLIP	23592263
MIRT470829	hsa-miR-4451	PAR-CLIP	23592263
MIRT470828	hsa-miR-376b-5p	PAR-CLIP	23592263
MIRT470827	hsa-miR-376c-5p	PAR-CLIP	23592263
MIRT470826	hsa-miR-3691-5p	PAR-CLIP	23592263
MIRT470825	hsa-miR-8056	PAR-CLIP	23592263
MIRT470824	hsa-miR-3911	PAR-CLIP	23592263
MIRT470823	hsa-miR-4314	PAR-CLIP	23592263
MIRT470822	hsa-miR-7156-3p	PAR-CLIP	23592263
MIRT470821	hsa-miR-1587	PAR-CLIP	23592263
MIRT470820	hsa-miR-3620-5p	PAR-CLIP	23592263
MIRT470819	hsa-miR-4752	PAR-CLIP	23592263
MIRT470818	hsa-miR-543	PAR-CLIP	23592263
MIRT470817	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT470816	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT470815	hsa-miR-4795-5p	PAR-CLIP	23592263
MIRT470814	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT470813	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT470812	hsa-miR-1914-3p	PAR-CLIP	23592263
MIRT470811	hsa-miR-5194	PAR-CLIP	23592263
MIRT470810	hsa-miR-4683	PAR-CLIP	23592263
MIRT470808	hsa-miR-4271	PAR-CLIP	23592263
MIRT470809	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT470807	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT470806	hsa-miR-4710	PAR-CLIP	23592263
MIRT470805	hsa-miR-3143	PAR-CLIP	23592263
MIRT470804	hsa-miR-6734-5p	PAR-CLIP	23592263
MIRT470803	hsa-miR-1270	PAR-CLIP	23592263
MIRT470802	hsa-miR-620	PAR-CLIP	23592263
MIRT726921	hsa-miR-27a-3p	HITS-CLIP	22473208
MIRT726920	hsa-miR-27b-3p	HITS-CLIP	22473208
MIRT470812	hsa-miR-1914-3p	RNA-seq	31722236
MIRT470867	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT470866	hsa-miR-4500	PAR-CLIP	23592263
MIRT470865	hsa-miR-4458	PAR-CLIP	23592263
MIRT470864	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT470863	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT470862	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT470861	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT470860	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT470859	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT470858	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT470857	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT470856	hsa-miR-3927-3p	PAR-CLIP	23592263
MIRT470855	hsa-miR-6831-5p	PAR-CLIP	23592263
MIRT470853	hsa-miR-4302	PAR-CLIP	23592263
MIRT470854	hsa-miR-199a-5p	PAR-CLIP	23592263
MIRT470852	hsa-miR-199b-5p	PAR-CLIP	23592263
MIRT470851	hsa-miR-3130-3p	PAR-CLIP	23592263
MIRT470849	hsa-miR-1285-3p	PAR-CLIP	23592263
MIRT470848	hsa-miR-3187-5p	PAR-CLIP	23592263
MIRT470847	hsa-miR-5189-5p	PAR-CLIP	23592263
MIRT470846	hsa-miR-612	PAR-CLIP	23592263
MIRT470844	hsa-miR-6860	PAR-CLIP	23592263
MIRT470845	hsa-miR-4486	PAR-CLIP	23592263
MIRT470843	hsa-miR-378g	PAR-CLIP	23592263
MIRT470842	hsa-miR-202-3p	PAR-CLIP	23592263
MIRT470841	hsa-miR-767-5p	PAR-CLIP	23592263
MIRT470840	hsa-miR-6744-5p	PAR-CLIP	23592263
MIRT470839	hsa-miR-1255a	PAR-CLIP	23592263
MIRT470838	hsa-miR-1255b-5p	PAR-CLIP	23592263
MIRT470829	hsa-miR-4451	PAR-CLIP	23592263
MIRT470828	hsa-miR-376b-5p	PAR-CLIP	23592263
MIRT470827	hsa-miR-376c-5p	PAR-CLIP	23592263
MIRT470826	hsa-miR-3691-5p	PAR-CLIP	23592263
MIRT470825	hsa-miR-8056	PAR-CLIP	23592263
MIRT470824	hsa-miR-3911	PAR-CLIP	23592263
MIRT470823	hsa-miR-4314	PAR-CLIP	23592263
MIRT470819	hsa-miR-4752	PAR-CLIP	23592263
MIRT470892	hsa-miR-552-3p	PAR-CLIP	23592263
MIRT470891	hsa-miR-4802-5p	PAR-CLIP	23592263
MIRT470890	hsa-miR-4534	PAR-CLIP	23592263
MIRT470889	hsa-miR-8082	PAR-CLIP	23592263
MIRT470888	hsa-miR-3689d	PAR-CLIP	23592263
MIRT470887	hsa-miR-6851-5p	PAR-CLIP	23592263
MIRT470886	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT470885	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT470883	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT470884	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT470882	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT470881	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT470880	hsa-miR-3144-5p	PAR-CLIP	23592263
MIRT470879	hsa-miR-3191-3p	PAR-CLIP	23592263
MIRT470878	hsa-miR-4652-5p	PAR-CLIP	23592263
MIRT470877	hsa-miR-1233-5p	PAR-CLIP	23592263
MIRT470876	hsa-miR-6778-5p	PAR-CLIP	23592263
MIRT470875	hsa-miR-1273h-5p	PAR-CLIP	23592263
MIRT470874	hsa-miR-30b-3p	PAR-CLIP	23592263
MIRT470873	hsa-miR-3689a-3p	PAR-CLIP	23592263
MIRT470872	hsa-miR-3689b-3p	PAR-CLIP	23592263
MIRT470870	hsa-miR-3689c	PAR-CLIP	23592263
MIRT470871	hsa-miR-6779-5p	PAR-CLIP	23592263
MIRT470869	hsa-miR-6780a-5p	PAR-CLIP	23592263
MIRT470868	hsa-miR-6810-5p	PAR-CLIP	23592263
MIRT470867	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT470866	hsa-miR-4500	PAR-CLIP	23592263
MIRT470865	hsa-miR-4458	PAR-CLIP	23592263
MIRT470864	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT470863	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT470862	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT470861	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT470860	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT470859	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT470858	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT470857	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT470856	hsa-miR-3927-3p	PAR-CLIP	23592263
MIRT470855	hsa-miR-6831-5p	PAR-CLIP	23592263
MIRT470853	hsa-miR-4302	PAR-CLIP	23592263
MIRT470854	hsa-miR-199a-5p	PAR-CLIP	23592263
MIRT470852	hsa-miR-199b-5p	PAR-CLIP	23592263
MIRT470851	hsa-miR-3130-3p	PAR-CLIP	23592263
MIRT470850	hsa-miR-1184	PAR-CLIP	23592263
MIRT470849	hsa-miR-1285-3p	PAR-CLIP	23592263
MIRT470848	hsa-miR-3187-5p	PAR-CLIP	23592263
MIRT470847	hsa-miR-5189-5p	PAR-CLIP	23592263
MIRT470846	hsa-miR-612	PAR-CLIP	23592263
MIRT470844	hsa-miR-6860	PAR-CLIP	23592263
MIRT470845	hsa-miR-4486	PAR-CLIP	23592263
MIRT470843	hsa-miR-378g	PAR-CLIP	23592263
MIRT470842	hsa-miR-202-3p	PAR-CLIP	23592263
MIRT470841	hsa-miR-767-5p	PAR-CLIP	23592263
MIRT470840	hsa-miR-6744-5p	PAR-CLIP	23592263
MIRT470839	hsa-miR-1255a	PAR-CLIP	23592263
MIRT470838	hsa-miR-1255b-5p	PAR-CLIP	23592263
MIRT470837	hsa-miR-4656	PAR-CLIP	23592263
MIRT470836	hsa-miR-6829-5p	PAR-CLIP	23592263
MIRT470834	hsa-miR-4492	PAR-CLIP	23592263
MIRT470835	hsa-miR-4498	PAR-CLIP	23592263
MIRT470833	hsa-miR-5001-5p	PAR-CLIP	23592263
MIRT470832	hsa-miR-762	PAR-CLIP	23592263
MIRT470831	hsa-miR-4675	PAR-CLIP	23592263
MIRT470830	hsa-miR-4741	PAR-CLIP	23592263
MIRT470829	hsa-miR-4451	PAR-CLIP	23592263
MIRT470828	hsa-miR-376b-5p	PAR-CLIP	23592263
MIRT470827	hsa-miR-376c-5p	PAR-CLIP	23592263
MIRT470826	hsa-miR-3691-5p	PAR-CLIP	23592263
MIRT470825	hsa-miR-8056	PAR-CLIP	23592263
MIRT470824	hsa-miR-3911	PAR-CLIP	23592263
MIRT470823	hsa-miR-4314	PAR-CLIP	23592263
MIRT470822	hsa-miR-7156-3p	PAR-CLIP	23592263
MIRT470821	hsa-miR-1587	PAR-CLIP	23592263
MIRT470820	hsa-miR-3620-5p	PAR-CLIP	23592263
MIRT470819	hsa-miR-4752	PAR-CLIP	23592263
MIRT470818	hsa-miR-543	PAR-CLIP	23592263
MIRT470817	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT470816	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT470815	hsa-miR-4795-5p	PAR-CLIP	23592263
MIRT470814	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT470813	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT470812	hsa-miR-1914-3p	PAR-CLIP	23592263
MIRT470811	hsa-miR-5194	PAR-CLIP	23592263
MIRT470810	hsa-miR-4683	PAR-CLIP	23592263
MIRT470808	hsa-miR-4271	PAR-CLIP	23592263
MIRT470809	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT470807	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT470806	hsa-miR-4710	PAR-CLIP	23592263
MIRT470805	hsa-miR-3143	PAR-CLIP	23592263
MIRT470804	hsa-miR-6734-5p	PAR-CLIP	23592263
MIRT470803	hsa-miR-1270	PAR-CLIP	23592263
MIRT470802	hsa-miR-620	PAR-CLIP	23592263
MIRT1243937	hsa-let-7a	CLIP-seq
MIRT1243938	hsa-let-7b	CLIP-seq
MIRT1243939	hsa-let-7c	CLIP-seq
MIRT1243940	hsa-let-7d	CLIP-seq
MIRT1243941	hsa-let-7e	CLIP-seq
MIRT1243942	hsa-let-7f	CLIP-seq
MIRT1243943	hsa-let-7g	CLIP-seq
MIRT1243944	hsa-let-7i	CLIP-seq
MIRT1243945	hsa-miR-1250	CLIP-seq
MIRT1243946	hsa-miR-1255b	CLIP-seq
MIRT1243947	hsa-miR-127-5p	CLIP-seq
MIRT1243948	hsa-miR-128	CLIP-seq
MIRT1243949	hsa-miR-1285	CLIP-seq
MIRT1243950	hsa-miR-1297	CLIP-seq
MIRT1243951	hsa-miR-1299	CLIP-seq
MIRT1243952	hsa-miR-132	CLIP-seq
MIRT1243953	hsa-miR-145	CLIP-seq
MIRT1243954	hsa-miR-1825	CLIP-seq
MIRT1243955	hsa-miR-1913	CLIP-seq
MIRT1243956	hsa-miR-202	CLIP-seq
MIRT1243957	hsa-miR-212	CLIP-seq
MIRT1243958	hsa-miR-223	CLIP-seq
MIRT1243959	hsa-miR-26a	CLIP-seq
MIRT1243960	hsa-miR-26b	CLIP-seq
MIRT1243961	hsa-miR-27a	CLIP-seq
MIRT1243962	hsa-miR-27b	CLIP-seq
MIRT1243963	hsa-miR-3065-5p	CLIP-seq
MIRT1243964	hsa-miR-3150a-3p	CLIP-seq
MIRT1243965	hsa-miR-3173-3p	CLIP-seq
MIRT1243966	hsa-miR-3175	CLIP-seq
MIRT1243967	hsa-miR-3176	CLIP-seq
MIRT1243968	hsa-miR-3180-5p	CLIP-seq
MIRT1243969	hsa-miR-3184	CLIP-seq
MIRT1243970	hsa-miR-3191	CLIP-seq
MIRT1243971	hsa-miR-324-3p	CLIP-seq
MIRT1243972	hsa-miR-326	CLIP-seq
MIRT1243973	hsa-miR-330-5p	CLIP-seq
MIRT1243974	hsa-miR-346	CLIP-seq
MIRT1243975	hsa-miR-3615	CLIP-seq
MIRT1243976	hsa-miR-3663-3p	CLIP-seq
MIRT1243977	hsa-miR-3907	CLIP-seq
MIRT1243978	hsa-miR-3909	CLIP-seq
MIRT1243979	hsa-miR-3922-3p	CLIP-seq
MIRT1243980	hsa-miR-3927	CLIP-seq
MIRT1243981	hsa-miR-3974	CLIP-seq
MIRT1243982	hsa-miR-4267	CLIP-seq
MIRT1243983	hsa-miR-4277	CLIP-seq
MIRT1243984	hsa-miR-4291	CLIP-seq
MIRT1243985	hsa-miR-4434	CLIP-seq
MIRT1243986	hsa-miR-4435	CLIP-seq
MIRT1243987	hsa-miR-4465	CLIP-seq
MIRT1243988	hsa-miR-4516	CLIP-seq
MIRT1243989	hsa-miR-451b	CLIP-seq
MIRT1243990	hsa-miR-4527	CLIP-seq
MIRT1243991	hsa-miR-4531	CLIP-seq
MIRT1243992	hsa-miR-4632	CLIP-seq
MIRT1243993	hsa-miR-4661-3p	CLIP-seq
MIRT1243994	hsa-miR-4667-5p	CLIP-seq
MIRT1243995	hsa-miR-4684-3p	CLIP-seq
MIRT1243996	hsa-miR-4700-5p	CLIP-seq
MIRT1243997	hsa-miR-4703-3p	CLIP-seq
MIRT1243998	hsa-miR-4707-3p	CLIP-seq
MIRT1243999	hsa-miR-4707-5p	CLIP-seq
MIRT1244000	hsa-miR-4721	CLIP-seq
MIRT1244001	hsa-miR-4755-3p	CLIP-seq
MIRT1244002	hsa-miR-4757-5p	CLIP-seq
MIRT1244003	hsa-miR-4779	CLIP-seq
MIRT1244004	hsa-miR-4796-3p	CLIP-seq
MIRT1244005	hsa-miR-513a-5p	CLIP-seq
MIRT1244006	hsa-miR-545	CLIP-seq
MIRT1244007	hsa-miR-548c-3p	CLIP-seq
MIRT1244008	hsa-miR-548t	CLIP-seq
MIRT1244009	hsa-miR-548v	CLIP-seq
MIRT1244010	hsa-miR-552	CLIP-seq
MIRT1244011	hsa-miR-562	CLIP-seq
MIRT1244012	hsa-miR-625	CLIP-seq
MIRT1244013	hsa-miR-637	CLIP-seq
MIRT1244014	hsa-miR-663b	CLIP-seq
MIRT1244015	hsa-miR-875-3p	CLIP-seq
MIRT1244016	hsa-miR-939	CLIP-seq
MIRT1244017	hsa-miR-98	CLIP-seq
MIRT1243948	hsa-miR-128	CLIP-seq
MIRT1552415	hsa-miR-1293	CLIP-seq
MIRT1243961	hsa-miR-27a	CLIP-seq
MIRT1243962	hsa-miR-27b	CLIP-seq
MIRT1552416	hsa-miR-4483	CLIP-seq
MIRT1244005	hsa-miR-513a-5p	CLIP-seq
MIRT1552417	hsa-miR-889	CLIP-seq
MIRT1243948	hsa-miR-128	CLIP-seq
MIRT1243937	hsa-let-7a	CLIP-seq
MIRT1243938	hsa-let-7b	CLIP-seq
MIRT1243939	hsa-let-7c	CLIP-seq
MIRT1243940	hsa-let-7d	CLIP-seq
MIRT1243941	hsa-let-7e	CLIP-seq
MIRT1243942	hsa-let-7f	CLIP-seq
MIRT1243943	hsa-let-7g	CLIP-seq
MIRT1243944	hsa-let-7i	CLIP-seq
MIRT1243946	hsa-miR-1255b	CLIP-seq
MIRT2072085	hsa-miR-1268	CLIP-seq
MIRT2072086	hsa-miR-1268b	CLIP-seq
MIRT2072087	hsa-miR-1275	CLIP-seq
MIRT1243947	hsa-miR-127-5p	CLIP-seq
MIRT1243948	hsa-miR-128	CLIP-seq
MIRT1243949	hsa-miR-1285	CLIP-seq
MIRT1243951	hsa-miR-1299	CLIP-seq
MIRT1243952	hsa-miR-132	CLIP-seq
MIRT2072088	hsa-miR-150	CLIP-seq
MIRT2072089	hsa-miR-15a	CLIP-seq
MIRT2072090	hsa-miR-15b	CLIP-seq
MIRT2072091	hsa-miR-16	CLIP-seq
MIRT2072092	hsa-miR-195	CLIP-seq
MIRT1243956	hsa-miR-202	CLIP-seq
MIRT2072093	hsa-miR-2113	CLIP-seq
MIRT1243957	hsa-miR-212	CLIP-seq
MIRT2072094	hsa-miR-218	CLIP-seq
MIRT1243958	hsa-miR-223	CLIP-seq
MIRT2072095	hsa-miR-3120-5p	CLIP-seq
MIRT2072096	hsa-miR-3132	CLIP-seq
MIRT1243965	hsa-miR-3173-3p	CLIP-seq
MIRT2072097	hsa-miR-3183	CLIP-seq
MIRT1243969	hsa-miR-3184	CLIP-seq
MIRT1243972	hsa-miR-326	CLIP-seq
MIRT1243973	hsa-miR-330-5p	CLIP-seq
MIRT2072098	hsa-miR-361-3p	CLIP-seq
MIRT2072099	hsa-miR-3622a-5p	CLIP-seq
MIRT1243981	hsa-miR-3974	CLIP-seq
MIRT2072100	hsa-miR-424	CLIP-seq
MIRT2072101	hsa-miR-4269	CLIP-seq
MIRT1243983	hsa-miR-4277	CLIP-seq
MIRT2072102	hsa-miR-4293	CLIP-seq
MIRT1243986	hsa-miR-4435	CLIP-seq
MIRT2072103	hsa-miR-4525	CLIP-seq
MIRT2072104	hsa-miR-4530	CLIP-seq
MIRT1243993	hsa-miR-4661-3p	CLIP-seq
MIRT2072105	hsa-miR-4665-5p	CLIP-seq
MIRT2072106	hsa-miR-4682	CLIP-seq
MIRT1243997	hsa-miR-4703-3p	CLIP-seq
MIRT2072107	hsa-miR-4713-5p	CLIP-seq
MIRT1244000	hsa-miR-4721	CLIP-seq
MIRT2072108	hsa-miR-4723-3p	CLIP-seq
MIRT2072109	hsa-miR-4723-5p	CLIP-seq
MIRT2072110	hsa-miR-4731-5p	CLIP-seq
MIRT2072111	hsa-miR-4738-3p	CLIP-seq
MIRT1244003	hsa-miR-4779	CLIP-seq
MIRT2072112	hsa-miR-497	CLIP-seq
MIRT1244005	hsa-miR-513a-5p	CLIP-seq
MIRT2072113	hsa-miR-532-3p	CLIP-seq
MIRT2072114	hsa-miR-548g	CLIP-seq
MIRT2072115	hsa-miR-564	CLIP-seq
MIRT2072116	hsa-miR-585	CLIP-seq
MIRT2072117	hsa-miR-622	CLIP-seq
MIRT1244012	hsa-miR-625	CLIP-seq
MIRT2072118	hsa-miR-636	CLIP-seq
MIRT1244014	hsa-miR-663b	CLIP-seq
MIRT1244015	hsa-miR-875-3p	CLIP-seq
MIRT1244016	hsa-miR-939	CLIP-seq
MIRT1244017	hsa-miR-98	CLIP-seq
MIRT1243937	hsa-let-7a	CLIP-seq
MIRT1243938	hsa-let-7b	CLIP-seq
MIRT1243939	hsa-let-7c	CLIP-seq
MIRT1243940	hsa-let-7d	CLIP-seq
MIRT1243941	hsa-let-7e	CLIP-seq
MIRT1243942	hsa-let-7f	CLIP-seq
MIRT1243943	hsa-let-7g	CLIP-seq
MIRT1243944	hsa-let-7i	CLIP-seq
MIRT1243946	hsa-miR-1255b	CLIP-seq
MIRT1243948	hsa-miR-128	CLIP-seq
MIRT1243949	hsa-miR-1285	CLIP-seq
MIRT1243955	hsa-miR-1913	CLIP-seq
MIRT1243956	hsa-miR-202	CLIP-seq
MIRT1243961	hsa-miR-27a	CLIP-seq
MIRT1243962	hsa-miR-27b	CLIP-seq
MIRT2299141	hsa-miR-3117-5p	CLIP-seq
MIRT2072095	hsa-miR-3120-5p	CLIP-seq
MIRT1243965	hsa-miR-3173-3p	CLIP-seq
MIRT1243969	hsa-miR-3184	CLIP-seq
MIRT1243971	hsa-miR-324-3p	CLIP-seq
MIRT2072099	hsa-miR-3622a-5p	CLIP-seq
MIRT1243978	hsa-miR-3909	CLIP-seq
MIRT1243980	hsa-miR-3927	CLIP-seq
MIRT2299142	hsa-miR-410	CLIP-seq
MIRT2072101	hsa-miR-4269	CLIP-seq
MIRT1243986	hsa-miR-4435	CLIP-seq
MIRT1243993	hsa-miR-4661-3p	CLIP-seq
MIRT2072106	hsa-miR-4682	CLIP-seq
MIRT1243999	hsa-miR-4707-5p	CLIP-seq
MIRT2072111	hsa-miR-4738-3p	CLIP-seq
MIRT1244003	hsa-miR-4779	CLIP-seq
MIRT1244005	hsa-miR-513a-5p	CLIP-seq
MIRT2072114	hsa-miR-548g	CLIP-seq
MIRT2072115	hsa-miR-564	CLIP-seq
MIRT2072117	hsa-miR-622	CLIP-seq
MIRT1244012	hsa-miR-625	CLIP-seq
MIRT1244014	hsa-miR-663b	CLIP-seq
MIRT1552417	hsa-miR-889	CLIP-seq
MIRT1244017	hsa-miR-98	CLIP-seq
MIRT1243947	hsa-miR-127-5p	CLIP-seq
MIRT1243948	hsa-miR-128	CLIP-seq
MIRT1243961	hsa-miR-27a	CLIP-seq
MIRT1243962	hsa-miR-27b	CLIP-seq
MIRT1243969	hsa-miR-3184	CLIP-seq
MIRT1243997	hsa-miR-4703-3p	CLIP-seq
MIRT1244005	hsa-miR-513a-5p	CLIP-seq
MIRT1244012	hsa-miR-625	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001525	Process	Angiogenesis	ISS
GO:0001569	Process	Branching involved in blood vessel morphogenesis	IEA
GO:0001822	Process	Kidney development	IEA
GO:0002116	Component	Semaphorin receptor complex	IBA
GO:0003151	Process	Outflow tract morphogenesis	IEA
GO:0003151	Process	Outflow tract morphogenesis	IEA
GO:0003151	Process	Outflow tract morphogenesis	TAS	26053665
GO:0003279	Process	Cardiac septum development	IEA
GO:0005515	Function	Protein binding	IPI	17318185, 24139859, 24841563, 32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0007162	Process	Negative regulation of cell adhesion	IBA
GO:0007416	Process	Synapse assembly	IBA
GO:0007416	Process	Synapse assembly	IEA
GO:0007416	Process	Synapse assembly	ISS
GO:0008039	Process	Synaptic target recognition	IEA
GO:0008360	Process	Regulation of cell shape	IBA
GO:0016020	Component	Membrane	IEA
GO:0017154	Function	Semaphorin receptor activity	IBA
GO:0017154	Function	Semaphorin receptor activity	IEA
GO:0017154	Function	Semaphorin receptor activity	ISS
GO:0019904	Function	Protein domain specific binding	IPI	24841563
GO:0030027	Component	Lamellipodium	IDA	24841563
GO:0030334	Process	Regulation of cell migration	IBA
GO:0030334	Process	Regulation of cell migration	IEA
GO:0030334	Process	Regulation of cell migration	ISS
GO:0030424	Component	Axon	IEA
GO:0031258	Component	Lamellipodium membrane	IEA
GO:0035904	Process	Aorta development	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043542	Process	Endothelial cell migration	IEA
GO:0043542	Process	Endothelial cell migration	ISS
GO:0044297	Component	Cell body	IEA
GO:0045765	Process	Regulation of angiogenesis	IEA
GO:0045765	Process	Regulation of angiogenesis	ISS
GO:0050772	Process	Positive regulation of axonogenesis	IBA
GO:0060666	Process	Dichotomous subdivision of terminal units involved in salivary gland branching	IEA
GO:0060976	Process	Coronary vasculature development	IEA
GO:0071526	Process	Semaphorin-plexin signaling pathway	IBA
GO:0071526	Process	Semaphorin-plexin signaling pathway	IEA
GO:0071526	Process	Semaphorin-plexin signaling pathway	ISS
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0120025	Component	Plasma membrane bounded cell projection	IEA

Other IDs

• MIM: 604282
• HGNC: 9107
• e!Ensembl: ENSG00000004399

Protein

• UniProt ID: Q9Y4D7
• Protein name: Plexin-D1
• Protein function: Cell surface receptor for SEMA4A and for class 3 semaphorins, such as SEMA3A, SEMA3C and SEMA3E. Plays an important role in cell-cell signaling, and in regulating the migration of a wide spectrum of cell types. Regulates the migration of thymocy
• PDB: 3H6N
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01403	Sema	61 → 526	Sema domain	Family
  PF01437	PSI	548 → 601	Plexin repeat	Family
  PF17960	TIG_plexin	606 → 700	TIG domain	Domain
  PF01437	PSI	701 → 753	Plexin repeat	Family
  PF01833	TIG	891 → 978	IPT/TIG domain	Domain
  PF01833	TIG	981 → 1065	IPT/TIG domain	Domain
  PF01833	TIG	1069 → 1150	IPT/TIG domain	Domain
  PF08337	Plexin_cytopl	1345 → 1888	Plexin cytoplasmic RasGAP domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected at low levels in heart, placenta, lung, skeletal muscle, kidney, thymus and liver. Detected at very low levels in brain, colon, spleen, small intestine and peripheral blood leukocytes. {ECO:0000269|PubMed:12412018}.
• Sequence:

  MAPRAAGGAPLSARAAAASPPPFQTPPRCPVPLLLLLLLGAARAGALEIQRRFPSPTPTN
  NFALDGAAGTVYLAAVNRLYQLSGANLSLEAEAAVGPVPDSPLCHAPQLPQASCEHPRRL
  TDNYNKILQLDPGQGLVVVCGSIYQGFCQLRRRGNISAVAVRFPPAAPPAEPVTVFPSML
  NVAANHPNASTVGLVLPPAAGAGGSRLLVGATYTGYGSSFFPRNRSLEDHRFENTPEIAI
  RSLDTRGDLAKLFTFDLNPSDDNILKIKQGAKEQHKLGFVSAFLHPSDPPPGAQSYAYLA
  LNSEARAGDKESQARSLLARICLPHGAGGDAKKLTESYIQLGLQCAGGAGRGDLYSRLVS
  VFPARERLFAVFERPQGSPAARAAPAALCAFRFADVRAAIRAARTACFVEPAPDVVAVLD
  SVVQGTGPACERKLNIQLQPEQLDCGAAHLQHPLSILQPLKATPVFRAPGLTSVAVASVN
  NYTAVFLGTVNGRLLKINLNESMQVVSRRVVTVAYGEPVHHVMQFDPADSGYLYLMTSHQ
  MARVKVAACNVHSTCGDCVGAADAYCGWCALETRCTLQQDCTNSSQQHFWTSASEGPSRC
  PAMTVLPSEIDVRQEYPGMILQISGSLPSLSGMEMACDYGNNIRTVARVPGPAFGHQIAY
  CNLLPRDQFPPFPPNQDHVTVEMSVRVNGRNIVKANFTIYDCSRTAQVYPHTACTSCLSA
  QWPCFWCSQQHSCVSNQSRCEASPNPTSPQDCPRTLLSPLAPVPTGGSQNILVPLANTAF
  FQGAALECSFGLEEIFEAVWVNESVVRCDQVVLHTTRKSQVFPLSLQLKGRPARFLDSPE
  PMTVMVYNCAMGSPDCSQCLGREDLGHLCMWSDGCRLRGPLQPMAGTCPAPEIHAIEPLS
  GPLDGGTLLTIRGRNLGRRLSDVAHGVWIGGVACEPLPDRYTVSEEIVCVTGPAPGPLSG
  VVTVNASKEGKSRDRFSYVLPLVHSLEPTMGPKAGGTRITIHGNDLHVGSELQVLVNDTD
  PCTELMRTDTSIACTMPEGALPAPVPVCVRFERRGCVHGNLTFWYMQNPVITAISPRRSP
  VSGGRTITVAGERFHMVQNVSMAVHHIGREPTLCKVLNSTLITCPSPGALSNASAPVDFF
  INGRAYADEVAVAEELLDPEEAQRGSRFRLDYLPNPQFSTAKREKWIKHHPGEPLTLVIH
  KEQDSLGLQSHEYRVKIGQVSCDIQIVSDRIIHCSVNESLGAAVGQLPITIQVGNFNQTI
  ATLQLGGSETAIIVSIVICSVLLLLSVVALFVFCTKSRRAERYWQKTLLQMEEMESQIRE
  EIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEERYVLPSQTLNS
  QGSSQAQETHPLLGEWKIPESCRPNMEEGISLFSSLLNNKHFLIVFVHALEQQKDFAVRD
  RCSLASLLTIALHGKLEYYTSIMKELLVDLIDASAAKNPKLMLRRTESVVEKMLTNWMSI
  CMYSCLRETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLSEEWLLRENIEAKPRNLNV
  SFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDLEWFASSTQSYIL
  RDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLIDKKDNTLGRVKDLDTEKYFHLVLPT
  DELAEPKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPPLAVKYF
  FDFLEEQAEKRGISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHIDACLSVIAQ
  AFIDACSISDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIQDMTPLSEQEMNAHLAEE
  SRKYQNEFNTNVAMAEIYKYAKRYRPQIMAALEANPTARRTQLQHKFEQVVALMEDNIYE
  CYSEA

• Sequence length: 1925

Pathways

Reactome:

Other semaphorin interactions
NOTCH3 Intracellular Domain Regulates Transcription

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Congenital heart defects, multiple types, 9	Pathogenic	rs2085164025, rs2533094115, rs2533302580, rs2085270404, rs1458204589	RCV003155528 RCV003155529 RCV003155530 RCV003155531 RCV003155532	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE, DIASTOLIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kleine-Levin syndrome	Uncertain significance; Likely benign	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Lung cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOBIUS SYNDROME	—	Disgenet Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oromandibular-limb hypogenesis spectrum	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PLXND1-related disorder	Benign; Likely benign; Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TETRALOGY OF FALLOT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	40185066	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic lateral sclerosis 1	Amyotrophic lateral sclerosis	Pubtator	40185066	Associate	★☆☆☆☆ Found in Text Mining only
Arthrogryposis	Arthrogryposis multiplex congenita	HPO_DG			★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	34539672	Associate	★☆☆☆☆ Found in Text Mining only
Blepharoptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Brachydactyly	Brachydactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	16166308, 19703316		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	19703316	Associate	★☆☆☆☆ Found in Text Mining only
Byzanthine arch palate	High palate	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cafe au lait spots, multiple	Cafe-au-lait spot	HPO_DG			★☆☆☆☆ Found in Text Mining only
Clinodactyly of the 5th finger	Camptodactyly of fingers	HPO_DG			★☆☆☆☆ Found in Text Mining only
Clumsiness - motor delay	Motor delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30231850	Associate	★☆☆☆☆ Found in Text Mining only
Congenital absence of breast	Breast aplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital clubfoot	Congenital Clubfoot	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital Epicanthus	Congenital Epicanthus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	18671865	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	30251099		★☆☆☆☆ Found in Text Mining only
Facial paralysis	Facial paralysis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	34539672	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure, Diastolic	Heart Failure	CTD_human_DG	29556499		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemorrhage	Hemorrhage	Pubtator	38103737	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	38103737	Associate	★☆☆☆☆ Found in Text Mining only
Hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27572291		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19703316, 31152824		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	18974298		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	18974298, 19703316		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28792859		★☆☆☆☆ Found in Text Mining only
Microdontia (disorder)	Microdontia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mobius II syndrome	Mobius Syndrome	ORPHANET_DG	26068067		★☆☆☆☆ Found in Text Mining only
Mobius Syndrome	Mobius Syndrome	BEFREE	15301830, 26068067, 31033088, 31152824		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mobius Syndrome	Mobius Syndrome	LHGDN	15301830		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mobius Syndrome	Mobius Syndrome	GENOMICS_ENGLAND_DG	24254849		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mobius Syndrome	Mobius Syndrome	ORPHANET_DG	26068067		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mobius Syndrome	Mobius syndrome	Pubtator	31033088	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Moebius syndrome	Moebius Syndrome	Orphanet			★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18974298, 19703316, 20664171, 31152824		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	21559368	Associate	★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	26292963, 32971928	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27572291		★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Syndactyly of fingers	Syndactyly of fingers	HPO_DG			★☆☆☆☆ Found in Text Mining only
Truncus Arteriosus, Persistent	Persistent truncus arteriosus	BEFREE	24254849, 31152824		★☆☆☆☆ Found in Text Mining only
Truncus Arteriosus, Persistent	Persistent truncus arteriosus	ORPHANET_DG	24254849		★☆☆☆☆ Found in Text Mining only
Truncus Arteriosus, Persistent	Persistent truncus arteriosus	GENOMICS_ENGLAND_DG	25713110		★☆☆☆☆ Found in Text Mining only