Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	23122
Gene name	Cytoplasmic linker associated protein 2
Gene symbol	CLASP2
Synonyms (NCBI Gene)	-
Chromosome	3
Chromosome location	3p22.3

168

Show/Hide all (168)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003180	hsa-miR-210-3p	immunoprecipitaionMicroarrayqRT-PCR	19826008
MIRT003180	hsa-miR-210-3p	immunoprecipitaionMicroarrayqRT-PCR	19826008
MIRT894378	hsa-miR-1305	CLIP-seq
MIRT894379	hsa-miR-141	CLIP-seq
MIRT894380	hsa-miR-200a	CLIP-seq
MIRT894381	hsa-miR-300	CLIP-seq
MIRT894382	hsa-miR-3128	CLIP-seq
MIRT894383	hsa-miR-3607-5p	CLIP-seq
MIRT894384	hsa-miR-381	CLIP-seq
MIRT894385	hsa-miR-3973	CLIP-seq
MIRT894386	hsa-miR-4470	CLIP-seq
MIRT894387	hsa-miR-4506	CLIP-seq
MIRT894388	hsa-miR-4666-3p	CLIP-seq
MIRT894389	hsa-miR-4747-5p	CLIP-seq
MIRT894390	hsa-miR-4789-5p	CLIP-seq
MIRT894391	hsa-miR-548k	CLIP-seq
MIRT894392	hsa-miR-569	CLIP-seq
MIRT894393	hsa-miR-607	CLIP-seq
MIRT894394	hsa-miR-7	CLIP-seq
MIRT894395	hsa-miR-128	CLIP-seq
MIRT894396	hsa-miR-3074-5p	CLIP-seq
MIRT894397	hsa-miR-3123	CLIP-seq
MIRT894398	hsa-miR-370	CLIP-seq
MIRT894399	hsa-miR-3925-5p	CLIP-seq
MIRT894400	hsa-miR-3941	CLIP-seq
MIRT894401	hsa-miR-3976	CLIP-seq
MIRT894402	hsa-miR-466	CLIP-seq
MIRT894403	hsa-miR-4672	CLIP-seq
MIRT894404	hsa-miR-548a-3p	CLIP-seq
MIRT894405	hsa-miR-548ae	CLIP-seq
MIRT894406	hsa-miR-548aj	CLIP-seq
MIRT894407	hsa-miR-548am	CLIP-seq
MIRT894408	hsa-miR-548e	CLIP-seq
MIRT894409	hsa-miR-548f	CLIP-seq
MIRT894410	hsa-miR-548x	CLIP-seq
MIRT1965243	hsa-miR-548aa	CLIP-seq
MIRT894378	hsa-miR-1305	CLIP-seq
MIRT1965244	hsa-miR-3673	CLIP-seq
MIRT894398	hsa-miR-370	CLIP-seq
MIRT1965245	hsa-miR-3924	CLIP-seq
MIRT1965246	hsa-miR-4328	CLIP-seq
MIRT894386	hsa-miR-4470	CLIP-seq
MIRT1965247	hsa-miR-4709-5p	CLIP-seq
MIRT1965248	hsa-miR-664	CLIP-seq
MIRT2201154	hsa-miR-1197	CLIP-seq
MIRT1965243	hsa-miR-548aa	CLIP-seq
MIRT894378	hsa-miR-1305	CLIP-seq
MIRT894386	hsa-miR-4470	CLIP-seq
MIRT2201155	hsa-miR-4540	CLIP-seq
MIRT2201156	hsa-miR-498	CLIP-seq
MIRT894398	hsa-miR-370	CLIP-seq
MIRT2201155	hsa-miR-4540	CLIP-seq
MIRT2447116	hsa-miR-1184	CLIP-seq
MIRT2447117	hsa-miR-1205	CLIP-seq
MIRT2447118	hsa-miR-3158-5p	CLIP-seq
MIRT2447119	hsa-miR-544	CLIP-seq
MIRT2447120	hsa-miR-548p	CLIP-seq
MIRT2447116	hsa-miR-1184	CLIP-seq
MIRT2447117	hsa-miR-1205	CLIP-seq
MIRT2503957	hsa-miR-1272	CLIP-seq
MIRT2503958	hsa-miR-1297	CLIP-seq
MIRT894378	hsa-miR-1305	CLIP-seq
MIRT2503959	hsa-miR-1323	CLIP-seq
MIRT2503960	hsa-miR-138	CLIP-seq
MIRT2503961	hsa-miR-151-3p	CLIP-seq
MIRT2503962	hsa-miR-186	CLIP-seq
MIRT2503963	hsa-miR-18a	CLIP-seq
MIRT2503964	hsa-miR-18b	CLIP-seq
MIRT2503965	hsa-miR-203	CLIP-seq
MIRT2503966	hsa-miR-2115	CLIP-seq
MIRT2503967	hsa-miR-2276	CLIP-seq
MIRT2503968	hsa-miR-26a	CLIP-seq
MIRT2503969	hsa-miR-26b	CLIP-seq
MIRT2503970	hsa-miR-3133	CLIP-seq
MIRT2503971	hsa-miR-3152-5p	CLIP-seq
MIRT2447118	hsa-miR-3158-5p	CLIP-seq
MIRT894383	hsa-miR-3607-5p	CLIP-seq
MIRT2503972	hsa-miR-3617	CLIP-seq
MIRT2503973	hsa-miR-3655	CLIP-seq
MIRT2503974	hsa-miR-3908	CLIP-seq
MIRT2503975	hsa-miR-3942-5p	CLIP-seq
MIRT894385	hsa-miR-3973	CLIP-seq
MIRT2503976	hsa-miR-4307	CLIP-seq
MIRT2503977	hsa-miR-4463	CLIP-seq
MIRT2503978	hsa-miR-4465	CLIP-seq
MIRT894386	hsa-miR-4470	CLIP-seq
MIRT2503979	hsa-miR-4496	CLIP-seq
MIRT2503980	hsa-miR-4499	CLIP-seq
MIRT894387	hsa-miR-4506	CLIP-seq
MIRT2503981	hsa-miR-4703-5p	CLIP-seq
MIRT2503982	hsa-miR-4705	CLIP-seq
MIRT2503983	hsa-miR-4735-3p	CLIP-seq
MIRT894389	hsa-miR-4747-5p	CLIP-seq
MIRT2503984	hsa-miR-4766-3p	CLIP-seq
MIRT2503985	hsa-miR-4768-5p	CLIP-seq
MIRT2503986	hsa-miR-4772-3p	CLIP-seq
MIRT2503987	hsa-miR-4774-3p	CLIP-seq
MIRT2503988	hsa-miR-4778-5p	CLIP-seq
MIRT2503989	hsa-miR-4795-3p	CLIP-seq
MIRT2201156	hsa-miR-498	CLIP-seq
MIRT2503990	hsa-miR-511	CLIP-seq
MIRT2503991	hsa-miR-516a-3p	CLIP-seq
MIRT2503992	hsa-miR-520g	CLIP-seq
MIRT2503993	hsa-miR-520h	CLIP-seq
MIRT2447119	hsa-miR-544	CLIP-seq
MIRT1965243	hsa-miR-548aa	CLIP-seq
MIRT2503994	hsa-miR-548c-3p	CLIP-seq
MIRT894391	hsa-miR-548k	CLIP-seq
MIRT2503995	hsa-miR-548o	CLIP-seq
MIRT2447120	hsa-miR-548p	CLIP-seq
MIRT2503996	hsa-miR-562	CLIP-seq
MIRT894392	hsa-miR-569	CLIP-seq
MIRT2503997	hsa-miR-592	CLIP-seq
MIRT2503998	hsa-miR-599	CLIP-seq
MIRT2503999	hsa-miR-618	CLIP-seq
MIRT2504000	hsa-miR-641	CLIP-seq
MIRT2504001	hsa-miR-656	CLIP-seq
MIRT894394	hsa-miR-7	CLIP-seq
MIRT2504002	hsa-miR-767-5p	CLIP-seq
MIRT2504003	hsa-miR-888	CLIP-seq
MIRT2504004	hsa-miR-935	CLIP-seq
MIRT2504005	hsa-miR-942	CLIP-seq
MIRT2447116	hsa-miR-1184	CLIP-seq
MIRT2447117	hsa-miR-1205	CLIP-seq
MIRT2503957	hsa-miR-1272	CLIP-seq
MIRT2503958	hsa-miR-1297	CLIP-seq
MIRT894378	hsa-miR-1305	CLIP-seq
MIRT2503959	hsa-miR-1323	CLIP-seq
MIRT2503960	hsa-miR-138	CLIP-seq
MIRT2503962	hsa-miR-186	CLIP-seq
MIRT2503963	hsa-miR-18a	CLIP-seq
MIRT2503964	hsa-miR-18b	CLIP-seq
MIRT2503965	hsa-miR-203	CLIP-seq
MIRT2503968	hsa-miR-26a	CLIP-seq
MIRT2503969	hsa-miR-26b	CLIP-seq
MIRT2503970	hsa-miR-3133	CLIP-seq
MIRT2447118	hsa-miR-3158-5p	CLIP-seq
MIRT894383	hsa-miR-3607-5p	CLIP-seq
MIRT2503972	hsa-miR-3617	CLIP-seq
MIRT2503973	hsa-miR-3655	CLIP-seq
MIRT2503974	hsa-miR-3908	CLIP-seq
MIRT2503975	hsa-miR-3942-5p	CLIP-seq
MIRT894385	hsa-miR-3973	CLIP-seq
MIRT2503978	hsa-miR-4465	CLIP-seq
MIRT894386	hsa-miR-4470	CLIP-seq
MIRT2503979	hsa-miR-4496	CLIP-seq
MIRT894387	hsa-miR-4506	CLIP-seq
MIRT2503981	hsa-miR-4703-5p	CLIP-seq
MIRT2503983	hsa-miR-4735-3p	CLIP-seq
MIRT894389	hsa-miR-4747-5p	CLIP-seq
MIRT2503984	hsa-miR-4766-3p	CLIP-seq
MIRT2503985	hsa-miR-4768-5p	CLIP-seq
MIRT2201156	hsa-miR-498	CLIP-seq
MIRT2503990	hsa-miR-511	CLIP-seq
MIRT2503992	hsa-miR-520g	CLIP-seq
MIRT2503993	hsa-miR-520h	CLIP-seq
MIRT2447119	hsa-miR-544	CLIP-seq
MIRT1965243	hsa-miR-548aa	CLIP-seq
MIRT894391	hsa-miR-548k	CLIP-seq
MIRT2503995	hsa-miR-548o	CLIP-seq
MIRT2447120	hsa-miR-548p	CLIP-seq
MIRT2503996	hsa-miR-562	CLIP-seq
MIRT894392	hsa-miR-569	CLIP-seq
MIRT2504000	hsa-miR-641	CLIP-seq
MIRT894394	hsa-miR-7	CLIP-seq
MIRT2504002	hsa-miR-767-5p	CLIP-seq
MIRT2504003	hsa-miR-888	CLIP-seq
MIRT2504005	hsa-miR-942	CLIP-seq

Show/Hide all (99)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000226	Process	Microtubule cytoskeleton organization	IMP	24859005, 26003921
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000776	Component	Kinetochore	IEA
GO:0000776	Component	Kinetochore	IMP	16866869
GO:0002162	Function	Dystroglycan binding	IEA
GO:0002162	Function	Dystroglycan binding	IPI	23940118
GO:0005515	Function	Protein binding	IPI	11290329, 17543864, 19632184, 26496610, 27173435, 33587225, 33961781, 35271311, 36931259
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	NAS	11290329
GO:0005794	Component	Golgi apparatus	IDA	11290329
GO:0005794	Component	Golgi apparatus	IEA
GO:0005802	Component	Trans-Golgi network	IDA	17543864
GO:0005813	Component	Centrosome	IEA
GO:0005815	Component	Microtubule organizing center	IBA
GO:0005819	Component	Spindle	IEA
GO:0005828	Component	Kinetochore microtubule	IEA
GO:0005828	Component	Kinetochore microtubule	TAS	12837247
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IDA	24859005
GO:0005874	Component	Microtubule	IDA	17543864, 20937854
GO:0005874	Component	Microtubule	IEA
GO:0005876	Component	Spindle microtubule	IBA
GO:0005881	Component	Cytoplasmic microtubule	IBA
GO:0005881	Component	Cytoplasmic microtubule	IDA	11290329
GO:0005881	Component	Cytoplasmic microtubule	IEA
GO:0005886	Component	Plasma membrane	IDA	20937854
GO:0005886	Component	Plasma membrane	IEA
GO:0005925	Component	Focal adhesion	IDA	24859005
GO:0005938	Component	Cell cortex	IDA	17113391
GO:0005938	Component	Cell cortex	IEA
GO:0006903	Process	Vesicle targeting	IEA
GO:0006903	Process	Vesicle targeting	IMP	24859005
GO:0007020	Process	Microtubule nucleation	IEA
GO:0007020	Process	Microtubule nucleation	IMP	17543864
GO:0007026	Process	Negative regulation of microtubule depolymerization	NAS	11290329
GO:0007030	Process	Golgi organization	IEA
GO:0007030	Process	Golgi organization	IMP	24859005
GO:0007052	Process	Mitotic spindle organization	IEA
GO:0007052	Process	Mitotic spindle organization	IMP	16866869
GO:0007163	Process	Establishment or maintenance of cell polarity	IEA
GO:0007163	Process	Establishment or maintenance of cell polarity	TAS	15928712
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IDA	24520051, 26003921
GO:0010458	Process	Exit from mitosis	IEA
GO:0010458	Process	Exit from mitosis	IMP	16866869
GO:0010470	Process	Regulation of gastrulation	IEA
GO:0010634	Process	Positive regulation of epithelial cell migration	IEA
GO:0010634	Process	Positive regulation of epithelial cell migration	IMP	24859005
GO:0010717	Process	Regulation of epithelial to mesenchymal transition	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0030516	Process	Regulation of axon extension	IDA	24520051
GO:0030981	Component	Cortical microtubule cytoskeleton	IEA
GO:0031023	Process	Microtubule organizing center organization	IEA
GO:0031023	Process	Microtubule organizing center organization	IMP	17543864
GO:0031110	Process	Regulation of microtubule polymerization or depolymerization	IEA
GO:0031110	Process	Regulation of microtubule polymerization or depolymerization	IMP	11290329
GO:0031113	Process	Regulation of microtubule polymerization	IDA	24520051
GO:0031252	Component	Cell leading edge	IDA	24859005
GO:0032587	Component	Ruffle membrane	IDA	20937854
GO:0032587	Component	Ruffle membrane	IEA
GO:0032886	Process	Regulation of microtubule-based process	IMP	20937854
GO:0032956	Process	Regulation of actin cytoskeleton organization	IDA	24520051
GO:0034453	Process	Microtubule anchoring	IEA
GO:0034453	Process	Microtubule anchoring	IMP	17543864, 24859005
GO:0035791	Process	Platelet-derived growth factor receptor-beta signaling pathway	IDA	24520051
GO:0040001	Process	Establishment of mitotic spindle localization	IBA
GO:0042995	Component	Cell projection	IEA
GO:0044295	Component	Axonal growth cone	IDA	24520051
GO:0045180	Component	Basal cortex	IBA
GO:0045180	Component	Basal cortex	IDA	23940118
GO:0045180	Component	Basal cortex	IEA
GO:0045921	Process	Positive regulation of exocytosis	IEA
GO:0045921	Process	Positive regulation of exocytosis	IMP	24859005
GO:0051010	Function	Microtubule plus-end binding	IDA	11290329, 19632184
GO:0051010	Function	Microtubule plus-end binding	IEA
GO:0051015	Function	Actin filament binding	IDA	24520051
GO:0051301	Process	Cell division	IEA
GO:0051497	Process	Negative regulation of stress fiber assembly	IEA
GO:0051497	Process	Negative regulation of stress fiber assembly	IMP	24859005
GO:0051893	Process	Regulation of focal adhesion assembly	IEA
GO:0051895	Process	Negative regulation of focal adhesion assembly	IMP	24859005
GO:0071711	Process	Basement membrane organization	IMP	23940118
GO:0072686	Component	Mitotic spindle	IMP	16866869
GO:0090091	Process	Positive regulation of extracellular matrix disassembly	IEA
GO:0090091	Process	Positive regulation of extracellular matrix disassembly	IMP	24859005
GO:0090307	Process	Mitotic spindle assembly	IBA
GO:0098978	Component	Glutamatergic synapse	IDA	23035100
GO:0098978	Component	Glutamatergic synapse	IMP	23035100
GO:0099187	Process	Presynaptic cytoskeleton organization	IDA	23035100
GO:0099187	Process	Presynaptic cytoskeleton organization	IMP	23035100
GO:1903690	Process	Negative regulation of wound healing, spreading of epidermal cells	IEA
GO:1903690	Process	Negative regulation of wound healing, spreading of epidermal cells	IMP	24859005
GO:1903754	Component	Cortical microtubule plus-end	IDA	24520051
GO:1904261	Process	Positive regulation of basement membrane assembly involved in embryonic body morphogenesis	IEA
GO:1990782	Function	Protein tyrosine kinase binding	IPI	24520051

MIM	HGNC	e!Ensembl
605853	17078	ENSG00000163539

O75122

Protein name

CLIP-associating protein 2 (Cytoplasmic linker-associated protein 2) (Protein Orbit homolog 2) (hOrbit2)

Protein function

Microtubule plus-end tracking protein that promotes the stabilization of dynamic microtubules (PubMed:26003921). Involved in the nucleation of noncentrosomal microtubules originating from the trans-Golgi network (TGN). Required for the polarizat

PDB

3WOY , 5NR4 , 8WHH , 8WHI , 8WHJ , 8WHK , 8WHL

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12348	CLASP_N	88 → 305	CLASP N terminal	Family

Tissue specificity

TISSUE SPECIFICITY: Brain-specific.

Sequence

MAMGDDKSFDDEESVDGNRPSSAASAFKVPAPKTSGNPANSARKPGSAGGPKVGGASKEG
GAGAVDEDDFIKAFTDVPSIQIYSSRELEETLNKIREILSDDKHDWDQRANALKKIRSLL
VAGAAQYDCFFQHLRLLDGALKLSAKDLRSQVVREACITVAHLSTVLGNKFDHGAEAIVP
TLFNLVPNSAKVMATSGCAAIRFIIRHTHVPRLIPLITSNCTSKSVPVRRRSFEFLDLLL
QEWQTHSLERHAAVLVETIKKGIHDADAEARVEARKTYMGLRNHFPGEAETLYNSLEPSY
QKSLQTYLKSSGSVASLPQSDRSSSSSQESLNRPFSSKWSTANPSTVAGRVSAGSSKASS
LPGSLQRSRSDIDVNAAAGAKAHHAAGQSVRSGRLGAGALNAGSYASLEDTSDKLDGTAS
EDGRVRAKLSAPLAGMGNAKADSRGRSRTKMVSQSQPGSRSGSPGRVLTTTALSTVSSGV
QRVLVNSASAQKRSKIPRSQGCSREASPSRLSVARSSRIPRPSVSQGCSREASRESSRDT
SPVRSFQPLASRHHSRSTGALYAPEVYGASGPGYGISQSSRLSSSVSAMRVLNTGSDVEE
AVADALKKPARRRYESYGMHSDDDANSDASSACSERSYSSRNGSIPTYMRQTEDVAEVLN
RCASSNWSERKEGLLGLQNLLKNQRTLSRVELKRLCEIFTRMFADPHGKRVFSMFLETLV
DFIQVHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRESFPNDLQFNILMRF
TVDQTQTPSLKVKVAILKYIETLAKQMDPGDFINSSETRLAVSRVITWTTEPKSSDVRKA
AQSVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHLRNTGNGTQSSMGSPLTRPTPR
SPANWSSPLTSPTNTSQNTLSPSAFDYDTENMNSEDIYSSLRGVTEAIQNFSFRSQEDMN
EPLKRDSKKDDGDSMCGGPGMSDPRAGGDATDSSQTALDNKASLLHSMPTHSSPRSRDYN
PYNYSDSISPFNKSALKEAMFDDDADQFPDDLSLDHSDLVAELLKELSNHNERVEERKIA
LYELMKLTQEESFSVWDEHFKTILLLLLETLGDKEPTIRALALKVLREILRHQPARFKNY
AELTVMKTLEAHKDPHKEVVRSAEEAASVLATSISPEQCIKVLCPIIQTADYPINLAAIK
MQTKVIERVSKETLNLLLPEIMPGLIQGYDNSESSVRKACVFCLVAVHAVIGDELKPHLS
QLTGSKMKLLNLYIKRAQTGSGGADPTTDVSGQS

Sequence length

1294

Interactions

View interactions

	Reactome
			Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal Separation of Sister Chromatids Resolution of Sister Chromatid Cohesion RHO GTPases Activate Formins Mitotic Prometaphase EML4 and NUDC in mitotic spindle formation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (13)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLASP2-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acth-Independent Macronodular Adrenal Hyperplasia	Cushing`s Syndrome	BEFREE	24700472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	20937854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28166762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	38022651	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28166762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	24127197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28166762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28166762, 31130343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	28166762, 31130343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	28166762	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CLASP2 (cytoplasmic linker associated protein 2)