Gene Gene information from NCBI Gene database.
Entrez ID 23118
Gene name TGF-beta activated kinase 1 (MAP3K7) binding protein 2
Gene symbol TAB2
Synonyms (NCBI Gene)
CHTD2MAP3K7IP2TAB-2
Chromosome 6
Chromosome location 6q25.1
Summary The protein encoded by this gene is an activator of MAP3K7/TAK1, which is required for for the IL-1 induced activation of nuclear factor kappaB and MAPK8/JNK. This protein forms a kinase complex with TRAF6, MAP3K7 and TAB1, and it thus serves as an adapto
SNPs SNP information provided by dbSNP.
13
SNP ID Visualize variation Clinical significance Consequence
rs143213478 A>G Conflicting-interpretations-of-pathogenicity Genic downstream transcript variant, coding sequence variant, synonymous variant
rs267607100 C>A Pathogenic Coding sequence variant, missense variant, genic downstream transcript variant
rs267607101 C>T Pathogenic Coding sequence variant, missense variant, genic downstream transcript variant
rs886041646 C>- Pathogenic Genic downstream transcript variant, coding sequence variant, stop gained
rs1057517934 C>T Likely-pathogenic Genic downstream transcript variant, stop gained, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
401
miRTarBase ID miRNA Experiments Reference
MIRT000289 hsa-miR-155-5p Review 20029422
MIRT000289 hsa-miR-155-5p Luciferase reporter assayMicroarrayqRT-PCRWestern blot 19193853
MIRT005057 hsa-let-7b-5p Microarray 17699775
MIRT000289 hsa-miR-155-5p Luciferase reporter assayMicroarrayqRT-PCRWestern blot 20852130
MIRT007040 hsa-miR-23b-3p Luciferase reporter assay 22660635
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
43
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 11460167, 11518704, 14743216, 16845370, 17158449, 17449468, 19026643, 19675569, 21512573, 21903422, 21988832, 22081109, 22158122, 22904686, 25260751, 27426733, 27880917, 32296183, 32707033, 33961781, 35271311, 36179048
GO:0005654 Component Nucleoplasm IEA
GO:0005654 Component Nucleoplasm TAS
GO:0005737 Component Cytoplasm IDA 10882101, 36681779
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605101 17075 ENSG00000055208
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NYJ8
Protein name TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 (Mitogen-activated protein kinase kinase kinase 7-interacting protein 2) (TAK1-binding protein 2) (TAB-2) (TGF-beta-activated kinase 1-binding protein 2)
Protein function Adapter required to activate the JNK and NF-kappa-B signaling pathways through the specific recognition of 'Lys-63'-linked polyubiquitin chains by its RanBP2-type zinc finger (NZF) (PubMed:10882101, PubMed:11460167, PubMed:15327770, PubMed:22158
PDB 2DAE , 2WWZ , 2WX0 , 2WX1 , 9AVT , 9AVW
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02845 CUE 9 50 CUE domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. In the embryo, expressed in the ventricular trabeculae, endothelial cells of the conotruncal cushions of the outflow tract and in the endothelial cells lining the developing aortic valves. {ECO:0000269|PubMed:10882101
Sequence
MAQGSHQIDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDL
NFSDDSGISGLRNHMTSLNLDLQSQNIYHHGREGSRMNGSRTLTHSISDGQLQGGQSNSE
LFQQEPQTAPAQVPQGFNVFGMSSSSGASNSAPHLGFHLGSKGTSSLSQQTPRFNPIMVT
LAPNIQTGRNTPTSLHIHGVPPPVLNSPQGNSIYIRPYITTPGGTTRQTQQHSGWVSQFN
PMNPQQVYQPSQPGPWTTCPASNPLSHTSSQQPNQQGHQTSHVYMPISSPTTSQPPTIHS
SGSSQSSAHSQYNIQNISTGPRKNQIEIKLEPPQRNNSSKLRSSGPRTSSTSSSVNSQTL
NRNQPTVYIAASPPNTDELMSRSQPKVYISANAATGDEQVMRNQPTLFISTNSGASAASR
NMSGQVSMGPAFIHHHPPKSRAIGNNSATSPRVVVTQPNTKYTFKITVSPNKPPAVSPGV
VSPTFELTNLLNHPDHYVETENIQHLTDPTLAHVDRISETRKLSMGSDDAAYTQALLVHQ
KARMERLQRELEIQKKKLDKLKSEVNEMENNLTRRRLKRSNSISQIPSLEEMQQLRSCNR
QLQIDIDCLTKEIDLFQARGPHFNPSAIHNFYDNIGFVGPVPPKPKDQRSIIKTPKTQDT
EDDEGAQWNCTACTFLNHPALIRCEQCEMPRHF
Sequence length 693
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  MAPK signaling pathway
NF-kappa B signaling pathway
Osteoclast differentiation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
IL-17 signaling pathway
TNF signaling pathway
Alcoholic liver disease
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Yersinia infection
Leishmaniasis
Toxoplasmosis
Hepatitis B
Measles
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Human immunodeficiency virus 1 infection
Coronavirus disease - COVID-19
Lipid and atherosclerosis
  Nuclear signaling by ERBB4
NOD1/2 Signaling Pathway
Downstream TCR signaling
FCERI mediated NF-kB activation
TAK1 activates NFkB by phosphorylation and activation of IKKs complex
activated TAK1 mediates p38 MAPK activation
JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1
TNFR1-induced NFkappaB signaling pathway
CLEC7A (Dectin-1) signaling
TICAM1,TRAF6-dependent induction of TAK1 complex
Interleukin-1 signaling
IRAK2 mediated activation of TAK1 complex
TRAF6-mediated induction of TAK1 complex within TLR4 complex
Alpha-protein kinase 1 signaling pathway
IRAK2 mediated activation of TAK1 complex upon TLR7/8 or 9 stimulation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
58
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Atrial septal defect, ostium secundum type Likely pathogenic; Pathogenic rs1057518422 RCV000626800
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Bicuspid aortic valve Likely pathogenic; Pathogenic rs1057518422 RCV000626800
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cardiac anomalies-short stature-joint hypermobility-facial dysmorphism syndrome due to TAB2 mutation Likely pathogenic; Pathogenic rs1479104927 RCV006257313
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Congenital heart defects, multiple types, 2 Likely pathogenic; Pathogenic rs1782223593, rs2114883576, rs2114885325, rs2114887873, rs2114887942, rs2114886711, rs1562443558, rs2483386818, rs2483397661, rs267607101, rs2483397256, rs2483386092, rs2483392655, rs577148408, rs2483399715
View all (16 more)
RCV001331939
RCV001353220
RCV001783844
RCV003336436
RCV003314027
View all (27 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ATRIAL FIBRILLATION GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BILIARY TRACT CANCER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BREAST CANCER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute pancreatitis Pancreatitis BEFREE 30944299
★☆☆☆☆
Found in Text Mining only
Anaplasia Anaplasia BEFREE 16732325
★☆☆☆☆
Found in Text Mining only
Anhydrotic Ectodermal Dysplasias Hypohidrotic ectodermal dysplasia BEFREE 16251197
★☆☆☆☆
Found in Text Mining only
Aortic Aneurysm Aortic Aneurysm HPO_DG
★☆☆☆☆
Found in Text Mining only
Aortic Valve Insufficiency Aortic Valve Insufficiency HPO_DG
★☆☆☆☆
Found in Text Mining only
Aortic Valve Stenosis Aortic Valve Sclerosis HPO_DG
★☆☆☆☆
Found in Text Mining only
Arthritis Psoriatic Psoriatic arthritis Pubtator 27706699 Inhibit
★☆☆☆☆
Found in Text Mining only
Asthma Asthma BEFREE 29676073
★☆☆☆☆
Found in Text Mining only
Atrial Fibrillation Atrial Fibrillation HPO_DG
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases Autoimmune Diseases BEFREE 16384851
★☆☆☆☆
Found in Text Mining only