Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	231
Gene name	Aldo-keto reductase family 1 member B
Gene symbol	AKR1B1
Synonyms (NCBI Gene)	ADRALDR1ALR2AR
Chromosome	7
Chromosome location	7q33
Summary	This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated i

146

Show/Hide all (146)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025547	hsa-miR-34a-5p	Proteomics	21566225
MIRT038212	hsa-miR-342-5p	CLASH	23622248
MIRT036537	hsa-miR-1226-3p	CLASH	23622248
MIRT776271	hsa-miR-214	CLIP-seq
MIRT776272	hsa-miR-3132	CLIP-seq
MIRT776273	hsa-miR-3154	CLIP-seq
MIRT776274	hsa-miR-330-3p	CLIP-seq
MIRT776275	hsa-miR-3619-5p	CLIP-seq
MIRT776276	hsa-miR-4530	CLIP-seq
MIRT776277	hsa-miR-4650-3p	CLIP-seq
MIRT776278	hsa-miR-761	CLIP-seq
MIRT776271	hsa-miR-214	CLIP-seq
MIRT1929130	hsa-miR-2355-5p	CLIP-seq
MIRT776272	hsa-miR-3132	CLIP-seq
MIRT776275	hsa-miR-3619-5p	CLIP-seq
MIRT1929131	hsa-miR-3679-3p	CLIP-seq
MIRT776276	hsa-miR-4530	CLIP-seq
MIRT776277	hsa-miR-4650-3p	CLIP-seq
MIRT776278	hsa-miR-761	CLIP-seq
MIRT776271	hsa-miR-214	CLIP-seq
MIRT1929130	hsa-miR-2355-5p	CLIP-seq
MIRT776272	hsa-miR-3132	CLIP-seq
MIRT776275	hsa-miR-3619-5p	CLIP-seq
MIRT1929131	hsa-miR-3679-3p	CLIP-seq
MIRT776276	hsa-miR-4530	CLIP-seq
MIRT776277	hsa-miR-4650-3p	CLIP-seq
MIRT776278	hsa-miR-761	CLIP-seq
MIRT2426161	hsa-miR-1972	CLIP-seq
MIRT2426162	hsa-miR-3148	CLIP-seq
MIRT2426163	hsa-miR-3662	CLIP-seq
MIRT2426164	hsa-miR-450b-5p	CLIP-seq
MIRT2426165	hsa-miR-4708-3p	CLIP-seq
MIRT2426166	hsa-miR-642b	CLIP-seq
MIRT2426161	hsa-miR-1972	CLIP-seq
MIRT2435292	hsa-miR-3660	CLIP-seq
MIRT2426164	hsa-miR-450b-5p	CLIP-seq
MIRT2435293	hsa-miR-4526	CLIP-seq
MIRT2426165	hsa-miR-4708-3p	CLIP-seq
MIRT2435294	hsa-miR-526b	CLIP-seq
MIRT2426166	hsa-miR-642b	CLIP-seq
MIRT2426161	hsa-miR-1972	CLIP-seq
MIRT2426164	hsa-miR-450b-5p	CLIP-seq
MIRT2426165	hsa-miR-4708-3p	CLIP-seq
MIRT2426166	hsa-miR-642b	CLIP-seq
MIRT2472638	hsa-miR-1264	CLIP-seq
MIRT2472639	hsa-miR-1304	CLIP-seq
MIRT2472640	hsa-miR-139-5p	CLIP-seq
MIRT2472641	hsa-miR-140-3p	CLIP-seq
MIRT2472642	hsa-miR-1827	CLIP-seq
MIRT2426161	hsa-miR-1972	CLIP-seq
MIRT2472643	hsa-miR-2110	CLIP-seq
MIRT2472644	hsa-miR-31	CLIP-seq
MIRT2472645	hsa-miR-3144-5p	CLIP-seq
MIRT2426162	hsa-miR-3148	CLIP-seq
MIRT2472646	hsa-miR-3150a-3p	CLIP-seq
MIRT2472647	hsa-miR-3156-3p	CLIP-seq
MIRT2472648	hsa-miR-3191	CLIP-seq
MIRT2472649	hsa-miR-3614-5p	CLIP-seq
MIRT2435292	hsa-miR-3660	CLIP-seq
MIRT2426163	hsa-miR-3662	CLIP-seq
MIRT2472650	hsa-miR-4301	CLIP-seq
MIRT2472651	hsa-miR-4305	CLIP-seq
MIRT2472652	hsa-miR-431	CLIP-seq
MIRT2472653	hsa-miR-4311	CLIP-seq
MIRT2426164	hsa-miR-450b-5p	CLIP-seq
MIRT2435293	hsa-miR-4526	CLIP-seq
MIRT2472654	hsa-miR-4652-5p	CLIP-seq
MIRT2472655	hsa-miR-4663	CLIP-seq
MIRT2472656	hsa-miR-4690-5p	CLIP-seq
MIRT2472657	hsa-miR-4701-5p	CLIP-seq
MIRT2426165	hsa-miR-4708-3p	CLIP-seq
MIRT2472658	hsa-miR-4719	CLIP-seq
MIRT2472659	hsa-miR-4742-5p	CLIP-seq
MIRT2472660	hsa-miR-4765	CLIP-seq
MIRT2435294	hsa-miR-526b	CLIP-seq
MIRT2472661	hsa-miR-552	CLIP-seq
MIRT2472662	hsa-miR-588	CLIP-seq
MIRT2472663	hsa-miR-626	CLIP-seq
MIRT2472664	hsa-miR-628-5p	CLIP-seq
MIRT2426166	hsa-miR-642b	CLIP-seq
MIRT2472665	hsa-miR-720	CLIP-seq
MIRT2472638	hsa-miR-1264	CLIP-seq
MIRT2472639	hsa-miR-1304	CLIP-seq
MIRT2674852	hsa-miR-133a	CLIP-seq
MIRT2674853	hsa-miR-133b	CLIP-seq
MIRT2472640	hsa-miR-139-5p	CLIP-seq
MIRT2472641	hsa-miR-140-3p	CLIP-seq
MIRT2674854	hsa-miR-145	CLIP-seq
MIRT2472642	hsa-miR-1827	CLIP-seq
MIRT2674855	hsa-miR-192	CLIP-seq
MIRT2426161	hsa-miR-1972	CLIP-seq
MIRT2472643	hsa-miR-2110	CLIP-seq
MIRT776271	hsa-miR-214	CLIP-seq
MIRT2674856	hsa-miR-215	CLIP-seq
MIRT1929130	hsa-miR-2355-5p	CLIP-seq
MIRT2472644	hsa-miR-31	CLIP-seq
MIRT776272	hsa-miR-3132	CLIP-seq
MIRT2472645	hsa-miR-3144-5p	CLIP-seq
MIRT2426162	hsa-miR-3148	CLIP-seq
MIRT2472646	hsa-miR-3150a-3p	CLIP-seq
MIRT776273	hsa-miR-3154	CLIP-seq
MIRT2472647	hsa-miR-3156-3p	CLIP-seq
MIRT2472648	hsa-miR-3191	CLIP-seq
MIRT776274	hsa-miR-330-3p	CLIP-seq
MIRT2674857	hsa-miR-3529	CLIP-seq
MIRT2674858	hsa-miR-3613-5p	CLIP-seq
MIRT2472649	hsa-miR-3614-5p	CLIP-seq
MIRT776275	hsa-miR-3619-5p	CLIP-seq
MIRT2435292	hsa-miR-3660	CLIP-seq
MIRT2674859	hsa-miR-3661	CLIP-seq
MIRT2426163	hsa-miR-3662	CLIP-seq
MIRT1929131	hsa-miR-3679-3p	CLIP-seq
MIRT2674860	hsa-miR-379	CLIP-seq
MIRT2674861	hsa-miR-3977	CLIP-seq
MIRT2674862	hsa-miR-4274	CLIP-seq
MIRT2472650	hsa-miR-4301	CLIP-seq
MIRT2472651	hsa-miR-4305	CLIP-seq
MIRT2472652	hsa-miR-431	CLIP-seq
MIRT2472653	hsa-miR-4311	CLIP-seq
MIRT2674863	hsa-miR-4451	CLIP-seq
MIRT2426164	hsa-miR-450b-5p	CLIP-seq
MIRT2435293	hsa-miR-4526	CLIP-seq
MIRT776276	hsa-miR-4530	CLIP-seq
MIRT776277	hsa-miR-4650-3p	CLIP-seq
MIRT2472654	hsa-miR-4652-5p	CLIP-seq
MIRT2472655	hsa-miR-4663	CLIP-seq
MIRT2472656	hsa-miR-4690-5p	CLIP-seq
MIRT2472657	hsa-miR-4701-5p	CLIP-seq
MIRT2426165	hsa-miR-4708-3p	CLIP-seq
MIRT2472658	hsa-miR-4719	CLIP-seq
MIRT2472659	hsa-miR-4742-5p	CLIP-seq
MIRT2674864	hsa-miR-4753-3p	CLIP-seq
MIRT2472660	hsa-miR-4765	CLIP-seq
MIRT2674865	hsa-miR-4766-5p	CLIP-seq
MIRT2674866	hsa-miR-488	CLIP-seq
MIRT2435294	hsa-miR-526b	CLIP-seq
MIRT2472661	hsa-miR-552	CLIP-seq
MIRT2472662	hsa-miR-588	CLIP-seq
MIRT2472663	hsa-miR-626	CLIP-seq
MIRT2472664	hsa-miR-628-5p	CLIP-seq
MIRT2674867	hsa-miR-631	CLIP-seq
MIRT2426166	hsa-miR-642b	CLIP-seq
MIRT2472665	hsa-miR-720	CLIP-seq
MIRT776278	hsa-miR-761	CLIP-seq
MIRT2674868	hsa-miR-9	CLIP-seq
MIRT2674869	hsa-miR-942	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
EGR1	Unknown	12890669

Show/Hide all (40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001523	Process	Retinoid metabolic process	IMP	12732097
GO:0001758	Function	Retinal dehydrogenase (NAD+) activity	IDA	12732097
GO:0002070	Process	Epithelial cell maturation	IEA
GO:0003091	Process	Renal water homeostasis	IEA
GO:0004032	Function	Aldose reductase (NADPH) activity	EXP	1420136, 2112546, 8645003
GO:0004032	Function	Aldose reductase (NADPH) activity	IBA
GO:0004032	Function	Aldose reductase (NADPH) activity	IDA	8435445
GO:0004032	Function	Aldose reductase (NADPH) activity	IEA
GO:0004032	Function	Aldose reductase (NADPH) activity	TAS	2112546
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005615	Component	Extracellular space	TAS	2112546
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005975	Process	Carbohydrate metabolic process	TAS	2112546
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006693	Process	Prostaglandin metabolic process	IEA
GO:0006700	Process	C21-steroid hormone biosynthetic process	TAS
GO:0009055	Function	Electron transfer activity	TAS	2112546
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0035809	Process	Regulation of urine volume	IEA
GO:0036130	Function	Prostaglandin H2 endoperoxidase reductase activity	IEA
GO:0042572	Process	Retinol metabolic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043795	Function	Glyceraldehyde oxidoreductase activity	IDA	20837989
GO:0044597	Process	Daunorubicin metabolic process	IMP	20837989
GO:0044598	Process	Doxorubicin metabolic process	IMP	20837989
GO:0046370	Process	Fructose biosynthetic process	IEA
GO:0046370	Process	Fructose biosynthetic process	TAS
GO:0047655	Function	Allyl-alcohol dehydrogenase activity	IEA
GO:0047939	Function	L-glucuronate reductase activity	IEA
GO:0047956	Function	Glycerol dehydrogenase (NADP+) activity	IEA
GO:0052650	Function	All-trans-retinol dehydrogenase (NADP+) activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:0071475	Process	Cellular hyperosmotic salinity response	IDA	8435445
GO:0072205	Process	Metanephric collecting duct development	IEA

MIM	HGNC	e!Ensembl
103880	381	ENSG00000085662

P15121

Protein name

Aldo-keto reductase family 1 member B1 (EC 1.1.1.21) (EC 1.1.1.300) (EC 1.1.1.372) (EC 1.1.1.54) (Aldehyde reductase) (Aldose reductase) (AR)

Protein function

Catalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols. Displays enzymatic activity towards endogenous metabolites such as aromatic and aliphatic aldehydes, ketones, monosachari

PDB

1ABN , 1ADS , 1AZ1 , 1AZ2 , 1EF3 , 1EL3 , 1IEI , 1MAR , 1PWL , 1PWM , 1T40 , 1T41 , 1US0 , 1X96 , 1X97 , 1X98 , 1XGD , 1Z3N , 1Z89 , 1Z8A , 2ACQ , 2ACR , 2ACS , 2ACU , 2AGT , 2DUX , 2DUZ , 2DV0 , 2F2K , 2FZ8 , 2FZ9 , 2FZB , 2FZD , 2HV5 , 2HVN , 2HVO , 2I16 , 2I17 , 2IKG , 2IKH , 2IKI , 2IKJ , 2INE , 2INZ , 2IPW , 2IQ0 , 2IQD , 2IS7 , 2ISF , 2J8T , 2NVC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00248	Aldo_ket_red	15 → 294	Aldo/keto reductase family	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in embryonic epithelial cells (EUE) in response to osmotic stress. {ECO:0000269|PubMed:8435445}.

Sequence

MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQ
EKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGK
EFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKP
AVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAK
HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCA
LLSCTSHKDYPFHEEF

Sequence length

316

Interactions

View interactions

	KEGG		Reactome
	Pentose and glucuronate interconversions Fructose and mannose metabolism Galactose metabolism Glycerolipid metabolism Folate biosynthesis Metabolic pathways		Pregnenolone biosynthesis Fructose biosynthesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ARTERIOSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLICATIONS OF DIABETES MELLITUS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES COMPLICATIONS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEUROPATHIES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (190)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	28199114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	14618619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	19288261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	22978663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	15181092, 24567419, 29539651, 29776746, 30308546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	15181092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	31321234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	14618619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age-related cortical cataract	Cortical cataract	BEFREE	30267098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	29726087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	30198788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	16127462, 18451330, 20466987, 21636809, 24186862, 26873505, 29891593		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	16197474, 17996583, 19752229, 19862939, 21334316, 29726087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	29726087	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	21276435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	16127462, 18451330, 20466987, 21636809, 24186862, 26873505, 29891593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	18451330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	18451330, 26873505	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	19077459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	28782465, 30245967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	14692651, 15183541, 17036319, 17725099, 20387147, 22051041, 23941826, 24866720, 25481438, 25818003, 26170067, 26842910, 27581212, 27758045, 28270406 View all (15 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35807227, 36454866	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35962452	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	18325492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	18325492, 24607627, 9565553	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	1309222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	21442234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	20466987, 21289629, 25169573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	21294693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	10915771, 11359468, 24360973, 25541468, 27160797, 28350848, 28580798, 28904737, 29038789, 29556442, 30025084, 30362099, 30844727, 31026421, 31656158, 7708723 View all (1 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cataract	Cataract	CTD_human_DG	21329682, 21376710, 25541468, 28137510		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	BEFREE	16911628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	14618619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	19862939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	16356117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	20353610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Insufficiency	Renal Insufficiency	BEFREE	20353610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type I	Cockayne Syndrome	BEFREE	11729242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	17018629, 21642355, 22978663, 23732517, 23827854, 28600556, 28786349, 30362099, 30532537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	17018629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27493446, 28600556, 28786349, 28929377, 29340817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17300864, 21576240, 23732517, 24393480, 27493446, 35807227, 36301939	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Disorders of Glycosylation	Congenital disorder of glycosylation	BEFREE	31636082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of adrenal gland	Congenital adrenal hypoplasia	BEFREE	15181092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	23029549, 30844728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	15746188, 19060123, 29190815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cortical cataract	Cortical cataract	BEFREE	30267098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing`s Syndrome	BEFREE	29440375, 29574994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystinosis	Cystinosis	Pubtator	18325349	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	29304089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	10944187, 10997684, 11095596, 12166624, 12943962, 14582038, 15736047, 18451330, 20424224, 25169573, 25541468, 26873505, 27835059, 28057038, 28124440 View all (13 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	14515207, 16356117, 2498333	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes Mellitus	BEFREE	10944187, 10997684, 11095596, 12166624, 12943962, 14582038, 15736047, 18451330, 20424224, 25169573, 25541468, 26873505, 27835059, 28057038, 28124440 View all (19 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	12943962, 14515207, 16356117, 16911628, 18451330, 21084309, 26873505, 35029856, 9760169	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	LHGDN	18451330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	11231353, 17563730, 9489533	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	14515207, 16911628, 18716049, 20353610, 35029856, 37218221	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10027585, 10746480, 11095596, 11182213, 11231353, 11874426, 12542725, 17563730, 19587357, 8777332, 9000706, 9215310, 9489533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10027585, 10510950, 10579460, 11095596, 11359468, 11449315, 11703436, 11796181, 11874426, 11940333, 12882871, 14582038, 15277434, 15569136, 15637423 View all (14 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	16911628	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	BEFREE	24186862, 27190083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	26579581, 29115286	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	11231353, 11422753, 18325349, 35029856	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	10027585, 10746480, 10944187, 10997684, 11231353, 11422753, 11703436, 11796181, 11841617, 11874426, 12166624, 12505748, 12542725, 14582038, 15270790 View all (17 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	14694017, 14694018, 15637423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	11701599, 12871135, 15095000, 16176189, 25529839, 28204799, 29238976, 29930278, 31636082, 9489533		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Neuropathies	Diabetic neuropathy	Pubtator	33820886, 9489533	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	10510950, 10656235, 11095596, 11449315, 12615520, 12660865, 12951282, 15270790, 15745835, 16176189, 16545977, 16701918, 17548166, 17563730, 19587357 View all (17 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic Retinopathy	LHGDN	12660865, 18385795		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	17563730, 20424224, 21067572, 29115286, 31539366, 37218221	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Disorder of eye	Disorder Of Eye	BEFREE	25541468, 30362099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	23146748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	CTD_human_DG	23146748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	CTD_human_DG	23146748		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrioma	Endometrioma	CTD_human_DG	25446850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	25446850		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	CTD_human_DG	25446850		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Hypertension	Hypertension	BEFREE	27343777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	29507217, 30651350, 31589122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	31589122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	21496801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	29705708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	10194473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	BEFREE	30198788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	37336288	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	8787680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	8787680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	2294193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	32778640, 35341178	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	21637955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	20150532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	18716049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	23029549, 30844728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	27105509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	10997684, 11422753, 11460589, 12606529, 12682618, 18451330, 19383984, 24186862, 24631337, 25541468, 25814526, 26873505, 28217947, 28557170, 28820747 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	11422753	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	19383984, 25283348, 26873505, 35029856, 40724989	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	18451330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	LHGDN	18451330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	18451330	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	11775127, 27343777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	Pubtator	24556878	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21576240	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Membranous Glomerulonephritis	Membranous Glomerulonephritis	BEFREE	30783455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory abnormality of the eye	Inflammatory abnormality of the eye	BEFREE	20642441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	18511740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	18511740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	10510950, 10746480, 11231353, 11422753, 11703436, 11874426, 12606529, 12882871, 14578247, 16176189, 18716049, 31743046, 8777332, 9215310, 9442813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	11231353, 11422753	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	15504980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	18716049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	21496801, 30567472	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	11172691, 15878840, 28927751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	19288261, 28042875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	29071720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	30062975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	15962362, 19422879, 28978011, 30850969, 9537432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Low Tension Glaucoma	Low Tension Glaucoma	BEFREE	20705341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of adrenal cortex	Adrenocortical carcinoma	BEFREE	15181092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	14692651, 15183541, 17036319, 17725099, 20387147, 22051041, 23941826, 24866720, 25481438, 25818003, 26170067, 26842910, 27581212, 27758045, 27855345 View all (16 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	23146748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	18325492, 19422879, 28978011, 9565553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	30062975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19077459, 30306507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31173853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	14662023, 15181092, 16406853, 20354121, 20444629, 21642355, 23852809, 24567419, 28259841, 28815573, 28929377, 29617059, 29705708, 29795767, 29948725, 30054832, 30362099, 31749429 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	17018629, 21642355, 22978663, 23732517, 23827854, 28600556, 28786349, 30362099, 30532537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	27769887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29847844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microangiopathy, Diabetic	Diabetic cardiomyopathy	BEFREE	16911628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Milroy Disease	Milroy Disease	BEFREE	28199114		★★★★★ ★☆☆☆☆ Found in Text Mining only
MOHR-TRANEBJAERG SYNDROME	MOHR-TRANEBJAERG SYNDROME	BEFREE	31411235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	30701416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	36680379	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	27322952	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	28529625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	15746188, 19060123, 29190815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	29020356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	17563730	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15181092, 19067123, 20354121, 23827854, 24406159, 27250110, 27855345, 27943612, 28115844, 28199114, 28243082, 28270406, 29179722, 29519418, 29618203 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	9489533	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	2112546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	25451566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	10510950, 11701599, 12871135, 30030901, 31743046, 9442813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	31589122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	31589122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	10954027, 11808891, 29507217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ocular Hypertension	Ocular Hypertension	BEFREE	30198788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy, Hereditary, Leber	Hereditary Leber Optic Atrophy	BEFREE	15728653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Neuropathy	Optic Neuropathy	BEFREE	15728653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	31812646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19077459, 30306507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	17270157, 27960106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	17270157	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	11808891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	15277434, 31802170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	15277434, 31802170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	34039789	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	28137510, 31026421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	29304089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	16545977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudoaphakia	Cataract	CTD_human_DG	21329682, 21376710, 25541468, 28137510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	36475041	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	15504980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	15504980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	CTD_human_DG	25070658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	10510950, 10579460, 10741565, 11095596, 11359468, 11449315, 11796181, 12542725, 12660865, 12882871, 16701918, 22658411, 25169573, 25541468, 27640118 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	BEFREE	29726087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	Pubtator	29726087	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	29726087	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rotator cuff syndrome	Rotator cuff syndrome	BEFREE	28483431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schwartz-Jampel Syndrome	Schwartz-Jampel Syndrome	BEFREE	21342226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28111134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Central	Sleep Apnea	BEFREE	11729242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	1310401, 15816546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28447762, 29507217, 29630881, 30651350, 31589122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stevens-Johnson Syndrome	Stevens-Johnson Syndrome	BEFREE	21342226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stevens-Johnson Syndrome Toxic Epidermal Necrolysis Spectrum	Stevens-Johnson Syndrome	BEFREE	28483310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28498440, 31173853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36221394, 36397644, 39375438	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	16911628	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	19407367	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	21342226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tumors of Adrenal Cortex	Tumors Of Adrenal Cortex	LHGDN	15181092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	21496801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	30362099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	20466987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	24556878	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	10194473		★★★★★ ★☆☆☆☆ Found in Text Mining only
X-linked Adrenal Hypoplasia	Adrenal Hypoplasia, X-Linked	BEFREE	15181092		★★★★★ ★☆☆☆☆ Found in Text Mining only

AKR1B1 (aldo-keto reductase family 1 member B)