Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	23095
Gene name	Kinesin family member 1B
Gene symbol	KIF1B
Synonyms (NCBI Gene)	CMT2CMT2ACMT2A1HMSNIIKLPNBLST1
Chromosome	1
Chromosome location	1p36.22
Summary	This gene encodes a motor protein that transports mitochondria and synaptic vesicle precursors. Mutations in this gene cause Charcot-Marie-Tooth disease, type 2A1. [provided by RefSeq, Jul 2008]

Show/Hide all (7)

SNP ID	Visualize variation	Clinical significance	Consequence
rs121908160	A>T	Pathogenic	Missense variant, coding sequence variant
rs121908161	A>T	Risk-factor	Missense variant, coding sequence variant
rs121908162	C>T	Likely-benign, risk-factor	Genic downstream transcript variant, missense variant, coding sequence variant
rs121908163	C>T	Likely-pathogenic, likely-benign, risk-factor	Genic downstream transcript variant, missense variant, coding sequence variant
rs139572764	T>A	Conflicting-interpretations-of-pathogenicity	Genic downstream transcript variant, missense variant, coding sequence variant
rs373698346	A>G	Likely-pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs587777883	G>T	Uncertain-significance, likely-pathogenic	Coding sequence variant, missense variant, intron variant

767

Show/Hide all (767)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016600	hsa-miR-193b-3p	Microarray	20304954
MIRT021443	hsa-miR-9-5p	Microarray	17612493
MIRT023106	hsa-miR-124-3p	Microarray	18668037
MIRT030116	hsa-miR-26b-5p	Microarray	19088304
MIRT031988	hsa-miR-16-5p	Microarray	21199864
MIRT051831	hsa-let-7c-5p	CLASH	23622248
MIRT046178	hsa-miR-27b-3p	CLASH	23622248
MIRT437676	hsa-miR-214-3p	MicroarrayqRT-PCR	22815788
MIRT445533	hsa-miR-4781-3p	HITS-CLIP	23824327
MIRT671069	hsa-miR-4716-5p	HITS-CLIP	23824327
MIRT671068	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT671067	hsa-miR-373-5p	HITS-CLIP	23824327
MIRT671066	hsa-miR-616-5p	HITS-CLIP	23824327
MIRT671065	hsa-miR-371a-5p	HITS-CLIP	23824327
MIRT671064	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT671063	hsa-miR-4750-3p	HITS-CLIP	23824327
MIRT671061	hsa-miR-3663-5p	HITS-CLIP	23824327
MIRT671062	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT671060	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT671058	hsa-miR-4755-3p	HITS-CLIP	23824327
MIRT671059	hsa-miR-6131	HITS-CLIP	23824327
MIRT671057	hsa-miR-197-3p	HITS-CLIP	23824327
MIRT671056	hsa-miR-4256	HITS-CLIP	23824327
MIRT671055	hsa-miR-548s	HITS-CLIP	23824327
MIRT671054	hsa-miR-4701-5p	HITS-CLIP	23824327
MIRT671053	hsa-miR-588	HITS-CLIP	23824327
MIRT671052	hsa-miR-4435	HITS-CLIP	23824327
MIRT671051	hsa-miR-3187-3p	HITS-CLIP	23824327
MIRT671050	hsa-miR-6843-3p	HITS-CLIP	23824327
MIRT671049	hsa-miR-6848-3p	HITS-CLIP	23824327
MIRT671048	hsa-miR-5096	HITS-CLIP	23824327
MIRT618744	hsa-miR-1910-3p	HITS-CLIP	23824327
MIRT618743	hsa-miR-6511a-5p	HITS-CLIP	23824327
MIRT618742	hsa-miR-126-5p	HITS-CLIP	23824327
MIRT618741	hsa-miR-4649-3p	HITS-CLIP	23824327
MIRT618740	hsa-miR-7162-3p	HITS-CLIP	23824327
MIRT618739	hsa-miR-1827	HITS-CLIP	23824327
MIRT618738	hsa-miR-4795-3p	HITS-CLIP	23824327
MIRT618737	hsa-miR-4303	HITS-CLIP	23824327
MIRT618736	hsa-miR-4762-3p	HITS-CLIP	23824327
MIRT445535	hsa-miR-548n	PAR-CLIP	22100165
MIRT445534	hsa-miR-548l	PAR-CLIP	22100165
MIRT445533	hsa-miR-4781-3p	PAR-CLIP	22100165
MIRT445532	hsa-miR-4635	PAR-CLIP	22100165
MIRT445531	hsa-miR-567	PAR-CLIP	22100165
MIRT445530	hsa-miR-431-5p	PAR-CLIP	22100165
MIRT445529	hsa-miR-6755-3p	PAR-CLIP	22100165
MIRT445528	hsa-miR-511-5p	PAR-CLIP	22100165
MIRT445535	hsa-miR-548n	PAR-CLIP	22100165
MIRT445534	hsa-miR-548l	PAR-CLIP	22100165
MIRT445533	hsa-miR-4781-3p	PAR-CLIP	22100165
MIRT445532	hsa-miR-4635	PAR-CLIP	22100165
MIRT445531	hsa-miR-567	PAR-CLIP	22100165
MIRT445530	hsa-miR-431-5p	PAR-CLIP	22100165
MIRT445529	hsa-miR-6755-3p	PAR-CLIP	22100165
MIRT445528	hsa-miR-511-5p	PAR-CLIP	22100165
MIRT128078	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT128091	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT128076	hsa-miR-32-5p	HITS-CLIP	22473208
MIRT445533	hsa-miR-4781-3p	HITS-CLIP	23824327
MIRT671069	hsa-miR-4716-5p	HITS-CLIP	23824327
MIRT671068	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT671067	hsa-miR-373-5p	HITS-CLIP	23824327
MIRT671066	hsa-miR-616-5p	HITS-CLIP	23824327
MIRT671065	hsa-miR-371a-5p	HITS-CLIP	23824327
MIRT671064	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT671063	hsa-miR-4750-3p	HITS-CLIP	23824327
MIRT671061	hsa-miR-3663-5p	HITS-CLIP	23824327
MIRT671062	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT671060	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT671058	hsa-miR-4755-3p	HITS-CLIP	23824327
MIRT671059	hsa-miR-6131	HITS-CLIP	23824327
MIRT671057	hsa-miR-197-3p	HITS-CLIP	23824327
MIRT671056	hsa-miR-4256	HITS-CLIP	23824327
MIRT671055	hsa-miR-548s	HITS-CLIP	23824327
MIRT671054	hsa-miR-4701-5p	HITS-CLIP	23824327
MIRT671053	hsa-miR-588	HITS-CLIP	23824327
MIRT671052	hsa-miR-4435	HITS-CLIP	23824327
MIRT671051	hsa-miR-3187-3p	HITS-CLIP	23824327
MIRT671050	hsa-miR-6843-3p	HITS-CLIP	23824327
MIRT671049	hsa-miR-6848-3p	HITS-CLIP	23824327
MIRT671048	hsa-miR-5096	HITS-CLIP	23824327
MIRT618744	hsa-miR-1910-3p	HITS-CLIP	23824327
MIRT618743	hsa-miR-6511a-5p	HITS-CLIP	23824327
MIRT618742	hsa-miR-126-5p	HITS-CLIP	23824327
MIRT618741	hsa-miR-4649-3p	HITS-CLIP	23824327
MIRT618740	hsa-miR-7162-3p	HITS-CLIP	23824327
MIRT618739	hsa-miR-1827	HITS-CLIP	23824327
MIRT618738	hsa-miR-4795-3p	HITS-CLIP	23824327
MIRT618737	hsa-miR-4303	HITS-CLIP	23824327
MIRT618736	hsa-miR-4762-3p	HITS-CLIP	23824327
MIRT445535	hsa-miR-548n	PAR-CLIP	22100165
MIRT445534	hsa-miR-548l	PAR-CLIP	22100165
MIRT445533	hsa-miR-4781-3p	PAR-CLIP	22100165
MIRT445532	hsa-miR-4635	PAR-CLIP	22100165
MIRT445531	hsa-miR-567	PAR-CLIP	22100165
MIRT445530	hsa-miR-431-5p	PAR-CLIP	22100165
MIRT445529	hsa-miR-6755-3p	PAR-CLIP	22100165
MIRT445528	hsa-miR-511-5p	PAR-CLIP	22100165
MIRT445535	hsa-miR-548n	PAR-CLIP	22100165
MIRT445534	hsa-miR-548l	PAR-CLIP	22100165
MIRT445533	hsa-miR-4781-3p	PAR-CLIP	22100165
MIRT445532	hsa-miR-4635	PAR-CLIP	22100165
MIRT445531	hsa-miR-567	PAR-CLIP	22100165
MIRT445530	hsa-miR-431-5p	PAR-CLIP	22100165
MIRT445529	hsa-miR-6755-3p	PAR-CLIP	22100165
MIRT445528	hsa-miR-511-5p	PAR-CLIP	22100165
MIRT1093566	hsa-miR-103a	CLIP-seq
MIRT1093567	hsa-miR-106a	CLIP-seq
MIRT1093568	hsa-miR-106b	CLIP-seq
MIRT1093569	hsa-miR-107	CLIP-seq
MIRT1093570	hsa-miR-1231	CLIP-seq
MIRT1093571	hsa-miR-1234	CLIP-seq
MIRT1093572	hsa-miR-1237	CLIP-seq
MIRT1093573	hsa-miR-1254	CLIP-seq
MIRT1093574	hsa-miR-1256	CLIP-seq
MIRT1093575	hsa-miR-1264	CLIP-seq
MIRT1093576	hsa-miR-1270	CLIP-seq
MIRT1093577	hsa-miR-1273f	CLIP-seq
MIRT1093578	hsa-miR-1287	CLIP-seq
MIRT1093579	hsa-miR-1292	CLIP-seq
MIRT1093580	hsa-miR-1294	CLIP-seq
MIRT1093581	hsa-miR-1324	CLIP-seq
MIRT1093582	hsa-miR-1343	CLIP-seq
MIRT1093583	hsa-miR-140-3p	CLIP-seq
MIRT1093584	hsa-miR-15a	CLIP-seq
MIRT1093585	hsa-miR-15b	CLIP-seq
MIRT1093586	hsa-miR-16	CLIP-seq
MIRT1093587	hsa-miR-17	CLIP-seq
MIRT1093588	hsa-miR-18a	CLIP-seq
MIRT1093589	hsa-miR-18b	CLIP-seq
MIRT1093590	hsa-miR-1910	CLIP-seq
MIRT1093591	hsa-miR-1912	CLIP-seq
MIRT1093592	hsa-miR-1913	CLIP-seq
MIRT1093593	hsa-miR-193a-3p	CLIP-seq
MIRT1093594	hsa-miR-193b	CLIP-seq
MIRT1093595	hsa-miR-195	CLIP-seq
MIRT1093596	hsa-miR-197	CLIP-seq
MIRT1093597	hsa-miR-203	CLIP-seq
MIRT1093598	hsa-miR-204	CLIP-seq
MIRT1093599	hsa-miR-205	CLIP-seq
MIRT1093600	hsa-miR-20a	CLIP-seq
MIRT1093601	hsa-miR-20b	CLIP-seq
MIRT1093602	hsa-miR-211	CLIP-seq
MIRT1093603	hsa-miR-2110	CLIP-seq
MIRT1093604	hsa-miR-214	CLIP-seq
MIRT1093605	hsa-miR-216a	CLIP-seq
MIRT1093606	hsa-miR-2277-3p	CLIP-seq
MIRT1093607	hsa-miR-24	CLIP-seq
MIRT1093608	hsa-miR-28-5p	CLIP-seq
MIRT1093609	hsa-miR-297	CLIP-seq
MIRT1093610	hsa-miR-302a	CLIP-seq
MIRT1093611	hsa-miR-302b	CLIP-seq
MIRT1093612	hsa-miR-302c	CLIP-seq
MIRT1093613	hsa-miR-302d	CLIP-seq
MIRT1093614	hsa-miR-302e	CLIP-seq
MIRT1093615	hsa-miR-3065-5p	CLIP-seq
MIRT1093616	hsa-miR-3116	CLIP-seq
MIRT1093617	hsa-miR-3130-5p	CLIP-seq
MIRT1093618	hsa-miR-3135b	CLIP-seq
MIRT1093619	hsa-miR-3139	CLIP-seq
MIRT1093620	hsa-miR-3148	CLIP-seq
MIRT1093621	hsa-miR-3149	CLIP-seq
MIRT1093622	hsa-miR-3150b-3p	CLIP-seq
MIRT1093623	hsa-miR-3160-3p	CLIP-seq
MIRT1093624	hsa-miR-3176	CLIP-seq
MIRT1093625	hsa-miR-3189-3p	CLIP-seq
MIRT1093626	hsa-miR-3192	CLIP-seq
MIRT1093627	hsa-miR-3194-3p	CLIP-seq
MIRT1093628	hsa-miR-324-3p	CLIP-seq
MIRT1093629	hsa-miR-335	CLIP-seq
MIRT1093630	hsa-miR-338-3p	CLIP-seq
MIRT1093631	hsa-miR-339-3p	CLIP-seq
MIRT1093632	hsa-miR-3545-3p	CLIP-seq
MIRT1093633	hsa-miR-3607-3p	CLIP-seq
MIRT1093634	hsa-miR-3619-5p	CLIP-seq
MIRT1093635	hsa-miR-362-5p	CLIP-seq
MIRT1093636	hsa-miR-3673	CLIP-seq
MIRT1093637	hsa-miR-370	CLIP-seq
MIRT1093638	hsa-miR-371-5p	CLIP-seq
MIRT1093639	hsa-miR-372	CLIP-seq
MIRT1093640	hsa-miR-373	CLIP-seq
MIRT1093641	hsa-miR-3908	CLIP-seq
MIRT1093642	hsa-miR-3913-3p	CLIP-seq
MIRT1093643	hsa-miR-3922-3p	CLIP-seq
MIRT1093644	hsa-miR-409-5p	CLIP-seq
MIRT1093645	hsa-miR-411	CLIP-seq
MIRT1093646	hsa-miR-421	CLIP-seq
MIRT1093647	hsa-miR-424	CLIP-seq
MIRT1093648	hsa-miR-4257	CLIP-seq
MIRT1093649	hsa-miR-4271	CLIP-seq
MIRT1093650	hsa-miR-4284	CLIP-seq
MIRT1093651	hsa-miR-4288	CLIP-seq
MIRT1093652	hsa-miR-4299	CLIP-seq
MIRT1093653	hsa-miR-4300	CLIP-seq
MIRT1093654	hsa-miR-431	CLIP-seq
MIRT1093655	hsa-miR-4310	CLIP-seq
MIRT1093656	hsa-miR-4314	CLIP-seq
MIRT1093657	hsa-miR-4316	CLIP-seq
MIRT1093658	hsa-miR-4328	CLIP-seq
MIRT1093659	hsa-miR-4329	CLIP-seq
MIRT1093660	hsa-miR-4446-5p	CLIP-seq
MIRT1093661	hsa-miR-4482	CLIP-seq
MIRT1093662	hsa-miR-4487	CLIP-seq
MIRT1093663	hsa-miR-4633-3p	CLIP-seq
MIRT1093664	hsa-miR-4638-3p	CLIP-seq
MIRT1093665	hsa-miR-4642	CLIP-seq
MIRT1093666	hsa-miR-4646-5p	CLIP-seq
MIRT1093667	hsa-miR-4677-3p	CLIP-seq
MIRT1093668	hsa-miR-4680-5p	CLIP-seq
MIRT1093669	hsa-miR-4683	CLIP-seq
MIRT1093670	hsa-miR-4689	CLIP-seq
MIRT1093671	hsa-miR-4690-5p	CLIP-seq
MIRT1093672	hsa-miR-4695-3p	CLIP-seq
MIRT1093673	hsa-miR-4707-3p	CLIP-seq
MIRT1093674	hsa-miR-4709-5p	CLIP-seq
MIRT1093675	hsa-miR-4725-3p	CLIP-seq
MIRT1093676	hsa-miR-4735-3p	CLIP-seq
MIRT1093677	hsa-miR-4742-5p	CLIP-seq
MIRT1093678	hsa-miR-4755-5p	CLIP-seq
MIRT1093679	hsa-miR-4760-5p	CLIP-seq
MIRT1093680	hsa-miR-4766-5p	CLIP-seq
MIRT1093681	hsa-miR-4772-3p	CLIP-seq
MIRT1093682	hsa-miR-4784	CLIP-seq
MIRT1093683	hsa-miR-4794	CLIP-seq
MIRT1093684	hsa-miR-4797-5p	CLIP-seq
MIRT1093685	hsa-miR-483-3p	CLIP-seq
MIRT1093686	hsa-miR-483-5p	CLIP-seq
MIRT1093687	hsa-miR-497	CLIP-seq
MIRT1093688	hsa-miR-500b	CLIP-seq
MIRT1093689	hsa-miR-512-3p	CLIP-seq
MIRT1093690	hsa-miR-513c	CLIP-seq
MIRT1093691	hsa-miR-514b-5p	CLIP-seq
MIRT1093692	hsa-miR-519d	CLIP-seq
MIRT1093693	hsa-miR-520a-3p	CLIP-seq
MIRT1093694	hsa-miR-520b	CLIP-seq
MIRT1093695	hsa-miR-520c-3p	CLIP-seq
MIRT1093696	hsa-miR-520d-3p	CLIP-seq
MIRT1093697	hsa-miR-520e	CLIP-seq
MIRT1093698	hsa-miR-520f	CLIP-seq
MIRT1093699	hsa-miR-539	CLIP-seq
MIRT1093700	hsa-miR-542-3p	CLIP-seq
MIRT1093701	hsa-miR-548t	CLIP-seq
MIRT1093702	hsa-miR-550a	CLIP-seq
MIRT1093703	hsa-miR-556-5p	CLIP-seq
MIRT1093704	hsa-miR-558	CLIP-seq
MIRT1093705	hsa-miR-620	CLIP-seq
MIRT1093706	hsa-miR-623	CLIP-seq
MIRT1093707	hsa-miR-624	CLIP-seq
MIRT1093708	hsa-miR-632	CLIP-seq
MIRT1093709	hsa-miR-636	CLIP-seq
MIRT1093710	hsa-miR-661	CLIP-seq
MIRT1093711	hsa-miR-708	CLIP-seq
MIRT1093712	hsa-miR-761	CLIP-seq
MIRT1093713	hsa-miR-875-3p	CLIP-seq
MIRT1093714	hsa-miR-885-3p	CLIP-seq
MIRT1093715	hsa-miR-892b	CLIP-seq
MIRT1093716	hsa-miR-920	CLIP-seq
MIRT1093717	hsa-miR-924	CLIP-seq
MIRT1093718	hsa-miR-93	CLIP-seq
MIRT1093719	hsa-miR-1184	CLIP-seq
MIRT1093720	hsa-miR-1227	CLIP-seq
MIRT1093721	hsa-miR-1273d	CLIP-seq
MIRT1093722	hsa-miR-1273e	CLIP-seq
MIRT1093723	hsa-miR-127-5p	CLIP-seq
MIRT1093724	hsa-miR-1276	CLIP-seq
MIRT1093725	hsa-miR-1297	CLIP-seq
MIRT1093726	hsa-miR-181a	CLIP-seq
MIRT1093727	hsa-miR-181b	CLIP-seq
MIRT1093728	hsa-miR-181c	CLIP-seq
MIRT1093729	hsa-miR-181d	CLIP-seq
MIRT1093730	hsa-miR-183	CLIP-seq
MIRT1093731	hsa-miR-2054	CLIP-seq
MIRT1093605	hsa-miR-216a	CLIP-seq
MIRT1093732	hsa-miR-216b	CLIP-seq
MIRT1093733	hsa-miR-219-5p	CLIP-seq
MIRT1093734	hsa-miR-2467-3p	CLIP-seq
MIRT1093735	hsa-miR-26a	CLIP-seq
MIRT1093736	hsa-miR-26b	CLIP-seq
MIRT1093737	hsa-miR-2964a-3p	CLIP-seq
MIRT1093738	hsa-miR-302f	CLIP-seq
MIRT1093739	hsa-miR-3065-3p	CLIP-seq
MIRT1093740	hsa-miR-31	CLIP-seq
MIRT1093741	hsa-miR-3122	CLIP-seq
MIRT1093742	hsa-miR-3125	CLIP-seq
MIRT1093623	hsa-miR-3160-3p	CLIP-seq
MIRT1093743	hsa-miR-3165	CLIP-seq
MIRT1093744	hsa-miR-3190	CLIP-seq
MIRT1093745	hsa-miR-3612	CLIP-seq
MIRT1093746	hsa-miR-3622a-3p	CLIP-seq
MIRT1093747	hsa-miR-3622b-3p	CLIP-seq
MIRT1093748	hsa-miR-3665	CLIP-seq
MIRT1093749	hsa-miR-3689a-3p	CLIP-seq
MIRT1093750	hsa-miR-3689c	CLIP-seq
MIRT1093751	hsa-miR-3714	CLIP-seq
MIRT1093752	hsa-miR-380	CLIP-seq
MIRT1093753	hsa-miR-382	CLIP-seq
MIRT1093754	hsa-miR-383	CLIP-seq
MIRT1093642	hsa-miR-3913-3p	CLIP-seq
MIRT1093755	hsa-miR-3913-5p	CLIP-seq
MIRT1093756	hsa-miR-3916	CLIP-seq
MIRT1093757	hsa-miR-4252	CLIP-seq
MIRT1093648	hsa-miR-4257	CLIP-seq
MIRT1093758	hsa-miR-4262	CLIP-seq
MIRT1093759	hsa-miR-4264	CLIP-seq
MIRT1093760	hsa-miR-4311	CLIP-seq
MIRT1093761	hsa-miR-4418	CLIP-seq
MIRT1093762	hsa-miR-4459	CLIP-seq
MIRT1093763	hsa-miR-4465	CLIP-seq
MIRT1093662	hsa-miR-4487	CLIP-seq
MIRT1093764	hsa-miR-4509	CLIP-seq
MIRT1093765	hsa-miR-4686	CLIP-seq
MIRT1093766	hsa-miR-4695-5p	CLIP-seq
MIRT1093767	hsa-miR-4728-5p	CLIP-seq
MIRT1093768	hsa-miR-4729	CLIP-seq
MIRT1093769	hsa-miR-4736	CLIP-seq
MIRT1093770	hsa-miR-4744	CLIP-seq
MIRT1093771	hsa-miR-4768-3p	CLIP-seq
MIRT1093772	hsa-miR-4772-5p	CLIP-seq
MIRT1093773	hsa-miR-4782-3p	CLIP-seq
MIRT1093774	hsa-miR-4793-3p	CLIP-seq
MIRT1093775	hsa-miR-4797-3p	CLIP-seq
MIRT1093776	hsa-miR-509-3-5p	CLIP-seq
MIRT1093777	hsa-miR-509-5p	CLIP-seq
MIRT1093778	hsa-miR-544b	CLIP-seq
MIRT1093704	hsa-miR-558	CLIP-seq
MIRT1093779	hsa-miR-583	CLIP-seq
MIRT1093780	hsa-miR-650	CLIP-seq
MIRT1093781	hsa-miR-660	CLIP-seq
MIRT1093782	hsa-miR-665	CLIP-seq
MIRT1093783	hsa-miR-885-5p	CLIP-seq
MIRT1093784	hsa-miR-940	CLIP-seq
MIRT1093722	hsa-miR-1273e	CLIP-seq
MIRT1093734	hsa-miR-2467-3p	CLIP-seq
MIRT1093738	hsa-miR-302f	CLIP-seq
MIRT1093623	hsa-miR-3160-3p	CLIP-seq
MIRT1093745	hsa-miR-3612	CLIP-seq
MIRT1093648	hsa-miR-4257	CLIP-seq
MIRT1093762	hsa-miR-4459	CLIP-seq
MIRT1093662	hsa-miR-4487	CLIP-seq
MIRT1093766	hsa-miR-4695-5p	CLIP-seq
MIRT1093704	hsa-miR-558	CLIP-seq
MIRT1093780	hsa-miR-650	CLIP-seq
MIRT1093782	hsa-miR-665	CLIP-seq
MIRT1922818	hsa-miR-125a-3p	CLIP-seq
MIRT1093596	hsa-miR-197	CLIP-seq
MIRT1093638	hsa-miR-371-5p	CLIP-seq
MIRT1922819	hsa-miR-3934	CLIP-seq
MIRT1093645	hsa-miR-411	CLIP-seq
MIRT1093686	hsa-miR-483-5p	CLIP-seq
MIRT1922820	hsa-miR-640	CLIP-seq
MIRT1922821	hsa-miR-764	CLIP-seq
MIRT2025081	hsa-miR-1183	CLIP-seq
MIRT2025082	hsa-miR-122	CLIP-seq
MIRT1093571	hsa-miR-1234	CLIP-seq
MIRT2025083	hsa-miR-1244	CLIP-seq
MIRT2025084	hsa-miR-1245b-5p	CLIP-seq
MIRT2025085	hsa-miR-1248	CLIP-seq
MIRT1922818	hsa-miR-125a-3p	CLIP-seq
MIRT1093578	hsa-miR-1287	CLIP-seq
MIRT2025086	hsa-miR-1291	CLIP-seq
MIRT2025087	hsa-miR-130a	CLIP-seq
MIRT2025088	hsa-miR-130b	CLIP-seq
MIRT1093581	hsa-miR-1324	CLIP-seq
MIRT1093582	hsa-miR-1343	CLIP-seq
MIRT2025089	hsa-miR-143	CLIP-seq
MIRT2025090	hsa-miR-149	CLIP-seq
MIRT2025091	hsa-miR-150	CLIP-seq
MIRT1093584	hsa-miR-15a	CLIP-seq
MIRT1093585	hsa-miR-15b	CLIP-seq
MIRT1093586	hsa-miR-16	CLIP-seq
MIRT1093592	hsa-miR-1913	CLIP-seq
MIRT1093593	hsa-miR-193a-3p	CLIP-seq
MIRT1093594	hsa-miR-193b	CLIP-seq
MIRT1093595	hsa-miR-195	CLIP-seq
MIRT2025092	hsa-miR-1976	CLIP-seq
MIRT2025093	hsa-miR-2115	CLIP-seq
MIRT1093604	hsa-miR-214	CLIP-seq
MIRT2025094	hsa-miR-22	CLIP-seq
MIRT2025095	hsa-miR-300	CLIP-seq
MIRT2025096	hsa-miR-301a	CLIP-seq
MIRT2025097	hsa-miR-301b	CLIP-seq
MIRT2025098	hsa-miR-3064-3p	CLIP-seq
MIRT2025099	hsa-miR-3064-5p	CLIP-seq
MIRT1093618	hsa-miR-3135b	CLIP-seq
MIRT2025100	hsa-miR-3142	CLIP-seq
MIRT1093621	hsa-miR-3149	CLIP-seq
MIRT2025101	hsa-miR-3159	CLIP-seq
MIRT2025102	hsa-miR-3173-3p	CLIP-seq
MIRT1093624	hsa-miR-3176	CLIP-seq
MIRT2025103	hsa-miR-3199	CLIP-seq
MIRT1093628	hsa-miR-324-3p	CLIP-seq
MIRT2025104	hsa-miR-328	CLIP-seq
MIRT2025105	hsa-miR-330-3p	CLIP-seq
MIRT2025106	hsa-miR-342-5p	CLIP-seq
MIRT2025107	hsa-miR-34b	CLIP-seq
MIRT1093633	hsa-miR-3607-3p	CLIP-seq
MIRT1093634	hsa-miR-3619-5p	CLIP-seq
MIRT2025108	hsa-miR-3652	CLIP-seq
MIRT2025109	hsa-miR-3666	CLIP-seq
MIRT1093638	hsa-miR-371-5p	CLIP-seq
MIRT2025110	hsa-miR-381	CLIP-seq
MIRT1093643	hsa-miR-3922-3p	CLIP-seq
MIRT1922819	hsa-miR-3934	CLIP-seq
MIRT1093647	hsa-miR-424	CLIP-seq
MIRT2025111	hsa-miR-4267	CLIP-seq
MIRT2025112	hsa-miR-4269	CLIP-seq
MIRT2025113	hsa-miR-4277	CLIP-seq
MIRT2025114	hsa-miR-4279	CLIP-seq
MIRT1093651	hsa-miR-4288	CLIP-seq
MIRT2025115	hsa-miR-4295	CLIP-seq
MIRT1093652	hsa-miR-4299	CLIP-seq
MIRT2025116	hsa-miR-4324	CLIP-seq
MIRT1093658	hsa-miR-4328	CLIP-seq
MIRT2025117	hsa-miR-4419a	CLIP-seq
MIRT2025118	hsa-miR-4430	CLIP-seq
MIRT2025119	hsa-miR-4434	CLIP-seq
MIRT2025120	hsa-miR-4438	CLIP-seq
MIRT2025121	hsa-miR-4469	CLIP-seq
MIRT2025122	hsa-miR-4510	CLIP-seq
MIRT2025123	hsa-miR-4514	CLIP-seq
MIRT2025124	hsa-miR-4516	CLIP-seq
MIRT2025125	hsa-miR-4521	CLIP-seq
MIRT2025126	hsa-miR-4527	CLIP-seq
MIRT2025127	hsa-miR-454	CLIP-seq
MIRT2025128	hsa-miR-4651	CLIP-seq
MIRT2025129	hsa-miR-4664-5p	CLIP-seq
MIRT2025130	hsa-miR-4692	CLIP-seq
MIRT2025131	hsa-miR-4693-3p	CLIP-seq
MIRT2025132	hsa-miR-4699-3p	CLIP-seq
MIRT2025133	hsa-miR-4705	CLIP-seq
MIRT1093673	hsa-miR-4707-3p	CLIP-seq
MIRT2025134	hsa-miR-4722-3p	CLIP-seq
MIRT2025135	hsa-miR-4742-3p	CLIP-seq
MIRT1093677	hsa-miR-4742-5p	CLIP-seq
MIRT2025136	hsa-miR-4756-3p	CLIP-seq
MIRT2025137	hsa-miR-4770	CLIP-seq
MIRT2025138	hsa-miR-4779	CLIP-seq
MIRT1093683	hsa-miR-4794	CLIP-seq
MIRT1093687	hsa-miR-497	CLIP-seq
MIRT2025139	hsa-miR-498	CLIP-seq
MIRT2025140	hsa-miR-5095	CLIP-seq
MIRT2025141	hsa-miR-545	CLIP-seq
MIRT1093701	hsa-miR-548t	CLIP-seq
MIRT2025142	hsa-miR-548u	CLIP-seq
MIRT2025143	hsa-miR-562	CLIP-seq
MIRT2025144	hsa-miR-582-5p	CLIP-seq
MIRT2025145	hsa-miR-603	CLIP-seq
MIRT2025146	hsa-miR-608	CLIP-seq
MIRT2025147	hsa-miR-614	CLIP-seq
MIRT2025148	hsa-miR-622	CLIP-seq
MIRT1093708	hsa-miR-632	CLIP-seq
MIRT1922820	hsa-miR-640	CLIP-seq
MIRT2025149	hsa-miR-642a	CLIP-seq
MIRT1093712	hsa-miR-761	CLIP-seq
MIRT1922821	hsa-miR-764	CLIP-seq
MIRT2025150	hsa-miR-767-3p	CLIP-seq
MIRT2025151	hsa-miR-888	CLIP-seq
MIRT1093784	hsa-miR-940	CLIP-seq
MIRT1093581	hsa-miR-1324	CLIP-seq
MIRT1093584	hsa-miR-15a	CLIP-seq
MIRT1093585	hsa-miR-15b	CLIP-seq
MIRT1093586	hsa-miR-16	CLIP-seq
MIRT1093595	hsa-miR-195	CLIP-seq
MIRT2256384	hsa-miR-3074-5p	CLIP-seq
MIRT2256385	hsa-miR-3120-3p	CLIP-seq
MIRT2256386	hsa-miR-34c-3p	CLIP-seq
MIRT1093638	hsa-miR-371-5p	CLIP-seq
MIRT1093647	hsa-miR-424	CLIP-seq
MIRT2256387	hsa-miR-4719	CLIP-seq
MIRT2256388	hsa-miR-4775	CLIP-seq
MIRT1093687	hsa-miR-497	CLIP-seq
MIRT2025141	hsa-miR-545	CLIP-seq
MIRT2256389	hsa-miR-590-3p	CLIP-seq
MIRT1093719	hsa-miR-1184	CLIP-seq
MIRT2256390	hsa-miR-1273	CLIP-seq
MIRT1093725	hsa-miR-1297	CLIP-seq
MIRT1093582	hsa-miR-1343	CLIP-seq
MIRT2256391	hsa-miR-198	CLIP-seq
MIRT1093605	hsa-miR-216a	CLIP-seq
MIRT1093732	hsa-miR-216b	CLIP-seq
MIRT2256392	hsa-miR-2355-3p	CLIP-seq
MIRT1093607	hsa-miR-24	CLIP-seq
MIRT1093735	hsa-miR-26a	CLIP-seq
MIRT1093736	hsa-miR-26b	CLIP-seq
MIRT1093739	hsa-miR-3065-3p	CLIP-seq
MIRT1093741	hsa-miR-3122	CLIP-seq
MIRT1093743	hsa-miR-3165	CLIP-seq
MIRT1093746	hsa-miR-3622a-3p	CLIP-seq
MIRT1093747	hsa-miR-3622b-3p	CLIP-seq
MIRT1093748	hsa-miR-3665	CLIP-seq
MIRT1093749	hsa-miR-3689a-3p	CLIP-seq
MIRT1093750	hsa-miR-3689c	CLIP-seq
MIRT1093751	hsa-miR-3714	CLIP-seq
MIRT2256393	hsa-miR-378g	CLIP-seq
MIRT1093755	hsa-miR-3913-5p	CLIP-seq
MIRT1093650	hsa-miR-4284	CLIP-seq
MIRT1093761	hsa-miR-4418	CLIP-seq
MIRT2256394	hsa-miR-4436a	CLIP-seq
MIRT2256395	hsa-miR-4437	CLIP-seq
MIRT1093763	hsa-miR-4465	CLIP-seq
MIRT2256396	hsa-miR-4486	CLIP-seq
MIRT2256397	hsa-miR-4501	CLIP-seq
MIRT2256398	hsa-miR-4646-3p	CLIP-seq
MIRT2256399	hsa-miR-4649-5p	CLIP-seq
MIRT2256400	hsa-miR-4674	CLIP-seq
MIRT2256401	hsa-miR-4690-3p	CLIP-seq
MIRT2256402	hsa-miR-4712-5p	CLIP-seq
MIRT1093767	hsa-miR-4728-5p	CLIP-seq
MIRT1093769	hsa-miR-4736	CLIP-seq
MIRT1093771	hsa-miR-4768-3p	CLIP-seq
MIRT1093774	hsa-miR-4793-3p	CLIP-seq
MIRT2025139	hsa-miR-498	CLIP-seq
MIRT1093776	hsa-miR-509-3-5p	CLIP-seq
MIRT1093777	hsa-miR-509-5p	CLIP-seq
MIRT1093710	hsa-miR-661	CLIP-seq
MIRT2256403	hsa-miR-770-5p	CLIP-seq
MIRT1093784	hsa-miR-940	CLIP-seq
MIRT2025082	hsa-miR-122	CLIP-seq
MIRT2025087	hsa-miR-130a	CLIP-seq
MIRT2025088	hsa-miR-130b	CLIP-seq
MIRT1093584	hsa-miR-15a	CLIP-seq
MIRT1093585	hsa-miR-15b	CLIP-seq
MIRT1093586	hsa-miR-16	CLIP-seq
MIRT2389861	hsa-miR-1909	CLIP-seq
MIRT2389862	hsa-miR-1911	CLIP-seq
MIRT1093595	hsa-miR-195	CLIP-seq
MIRT1093604	hsa-miR-214	CLIP-seq
MIRT2389863	hsa-miR-298	CLIP-seq
MIRT2025096	hsa-miR-301a	CLIP-seq
MIRT2025097	hsa-miR-301b	CLIP-seq
MIRT1093618	hsa-miR-3135b	CLIP-seq
MIRT1093634	hsa-miR-3619-5p	CLIP-seq
MIRT2025108	hsa-miR-3652	CLIP-seq
MIRT2025109	hsa-miR-3666	CLIP-seq
MIRT1093647	hsa-miR-424	CLIP-seq
MIRT2025115	hsa-miR-4295	CLIP-seq
MIRT2025118	hsa-miR-4430	CLIP-seq
MIRT1093660	hsa-miR-4446-5p	CLIP-seq
MIRT2025127	hsa-miR-454	CLIP-seq
MIRT1093687	hsa-miR-497	CLIP-seq
MIRT1093712	hsa-miR-761	CLIP-seq
MIRT2430432	hsa-miR-4724-3p	CLIP-seq
MIRT2025142	hsa-miR-548u	CLIP-seq
MIRT1093633	hsa-miR-3607-3p	CLIP-seq
MIRT2452585	hsa-miR-1224-3p	CLIP-seq
MIRT2452586	hsa-miR-1260	CLIP-seq
MIRT2452587	hsa-miR-1260b	CLIP-seq
MIRT2452588	hsa-miR-1280	CLIP-seq
MIRT1093582	hsa-miR-1343	CLIP-seq
MIRT2025091	hsa-miR-150	CLIP-seq
MIRT1093596	hsa-miR-197	CLIP-seq
MIRT2025092	hsa-miR-1976	CLIP-seq
MIRT1093608	hsa-miR-28-5p	CLIP-seq
MIRT1093619	hsa-miR-3139	CLIP-seq
MIRT1093621	hsa-miR-3149	CLIP-seq
MIRT1093622	hsa-miR-3150b-3p	CLIP-seq
MIRT2452589	hsa-miR-3155	CLIP-seq
MIRT2452590	hsa-miR-3155b	CLIP-seq
MIRT2025103	hsa-miR-3199	CLIP-seq
MIRT2452591	hsa-miR-324-5p	CLIP-seq
MIRT1093645	hsa-miR-411	CLIP-seq
MIRT2025112	hsa-miR-4269	CLIP-seq
MIRT2025113	hsa-miR-4277	CLIP-seq
MIRT2025114	hsa-miR-4279	CLIP-seq
MIRT2025120	hsa-miR-4438	CLIP-seq
MIRT1093663	hsa-miR-4633-3p	CLIP-seq
MIRT1093670	hsa-miR-4689	CLIP-seq
MIRT2025134	hsa-miR-4722-3p	CLIP-seq
MIRT1093682	hsa-miR-4784	CLIP-seq
MIRT1093683	hsa-miR-4794	CLIP-seq
MIRT1093686	hsa-miR-483-5p	CLIP-seq
MIRT2452592	hsa-miR-484	CLIP-seq
MIRT2025139	hsa-miR-498	CLIP-seq
MIRT2025140	hsa-miR-5095	CLIP-seq
MIRT1093711	hsa-miR-708	CLIP-seq
MIRT2452585	hsa-miR-1224-3p	CLIP-seq
MIRT2452586	hsa-miR-1260	CLIP-seq
MIRT2452587	hsa-miR-1260b	CLIP-seq
MIRT2452588	hsa-miR-1280	CLIP-seq
MIRT1093608	hsa-miR-28-5p	CLIP-seq
MIRT1093619	hsa-miR-3139	CLIP-seq
MIRT1093622	hsa-miR-3150b-3p	CLIP-seq
MIRT2452591	hsa-miR-324-5p	CLIP-seq
MIRT1093663	hsa-miR-4633-3p	CLIP-seq
MIRT1093670	hsa-miR-4689	CLIP-seq
MIRT1093682	hsa-miR-4784	CLIP-seq
MIRT1093711	hsa-miR-708	CLIP-seq
MIRT2557890	hsa-miR-1182	CLIP-seq
MIRT1093719	hsa-miR-1184	CLIP-seq
MIRT2557891	hsa-miR-1193	CLIP-seq
MIRT2025082	hsa-miR-122	CLIP-seq
MIRT2557892	hsa-miR-1255a	CLIP-seq
MIRT2557893	hsa-miR-1255b	CLIP-seq
MIRT2557894	hsa-miR-1271	CLIP-seq
MIRT1093724	hsa-miR-1276	CLIP-seq
MIRT2557895	hsa-miR-128	CLIP-seq
MIRT2025086	hsa-miR-1291	CLIP-seq
MIRT2025087	hsa-miR-130a	CLIP-seq
MIRT2025088	hsa-miR-130b	CLIP-seq
MIRT1093582	hsa-miR-1343	CLIP-seq
MIRT2557896	hsa-miR-138	CLIP-seq
MIRT2557897	hsa-miR-1470	CLIP-seq
MIRT2025091	hsa-miR-150	CLIP-seq
MIRT2557898	hsa-miR-1587	CLIP-seq
MIRT2557899	hsa-miR-182	CLIP-seq
MIRT2557900	hsa-miR-188-5p	CLIP-seq
MIRT1093590	hsa-miR-1910	CLIP-seq
MIRT2557901	hsa-miR-1914	CLIP-seq
MIRT2557902	hsa-miR-1915	CLIP-seq
MIRT1093596	hsa-miR-197	CLIP-seq
MIRT2025092	hsa-miR-1976	CLIP-seq
MIRT1093732	hsa-miR-216b	CLIP-seq
MIRT1093607	hsa-miR-24	CLIP-seq
MIRT2557903	hsa-miR-27a	CLIP-seq
MIRT2557904	hsa-miR-27b	CLIP-seq
MIRT2025096	hsa-miR-301a	CLIP-seq
MIRT2025097	hsa-miR-301b	CLIP-seq
MIRT2025098	hsa-miR-3064-3p	CLIP-seq
MIRT2025099	hsa-miR-3064-5p	CLIP-seq
MIRT1093740	hsa-miR-31	CLIP-seq
MIRT1093618	hsa-miR-3135b	CLIP-seq
MIRT1093621	hsa-miR-3149	CLIP-seq
MIRT2452589	hsa-miR-3155	CLIP-seq
MIRT2452590	hsa-miR-3155b	CLIP-seq
MIRT2025102	hsa-miR-3173-3p	CLIP-seq
MIRT2557905	hsa-miR-3173-5p	CLIP-seq
MIRT1093624	hsa-miR-3176	CLIP-seq
MIRT2557906	hsa-miR-3200-5p	CLIP-seq
MIRT2557907	hsa-miR-323-5p	CLIP-seq
MIRT2025104	hsa-miR-328	CLIP-seq
MIRT2557908	hsa-miR-339-5p	CLIP-seq
MIRT2557909	hsa-miR-342-3p	CLIP-seq
MIRT2557910	hsa-miR-3605-5p	CLIP-seq
MIRT1093633	hsa-miR-3607-3p	CLIP-seq
MIRT2557911	hsa-miR-3616-3p	CLIP-seq
MIRT2025108	hsa-miR-3652	CLIP-seq
MIRT2557912	hsa-miR-3663-3p	CLIP-seq
MIRT2025109	hsa-miR-3666	CLIP-seq
MIRT2557913	hsa-miR-3680	CLIP-seq
MIRT2557914	hsa-miR-3919	CLIP-seq
MIRT1093643	hsa-miR-3922-3p	CLIP-seq
MIRT1093645	hsa-miR-411	CLIP-seq
MIRT2557915	hsa-miR-4260	CLIP-seq
MIRT2557916	hsa-miR-4268	CLIP-seq
MIRT2025113	hsa-miR-4277	CLIP-seq
MIRT2025114	hsa-miR-4279	CLIP-seq
MIRT2557917	hsa-miR-4283	CLIP-seq
MIRT1093650	hsa-miR-4284	CLIP-seq
MIRT2025115	hsa-miR-4295	CLIP-seq
MIRT1093657	hsa-miR-4316	CLIP-seq
MIRT1093761	hsa-miR-4418	CLIP-seq
MIRT2025118	hsa-miR-4430	CLIP-seq
MIRT2557918	hsa-miR-4448	CLIP-seq
MIRT2557919	hsa-miR-4450	CLIP-seq
MIRT2557920	hsa-miR-4456	CLIP-seq
MIRT1093762	hsa-miR-4459	CLIP-seq
MIRT2557921	hsa-miR-4489	CLIP-seq
MIRT2557922	hsa-miR-4492	CLIP-seq
MIRT2557923	hsa-miR-4494	CLIP-seq
MIRT2557924	hsa-miR-4498	CLIP-seq
MIRT2557925	hsa-miR-4505	CLIP-seq
MIRT2025127	hsa-miR-454	CLIP-seq
MIRT2557926	hsa-miR-4656	CLIP-seq
MIRT2557927	hsa-miR-4667-3p	CLIP-seq
MIRT2557928	hsa-miR-4675	CLIP-seq
MIRT2557929	hsa-miR-4680-3p	CLIP-seq
MIRT2557930	hsa-miR-4710	CLIP-seq
MIRT2557931	hsa-miR-4712-3p	CLIP-seq
MIRT2557932	hsa-miR-4715-3p	CLIP-seq
MIRT2256387	hsa-miR-4719	CLIP-seq
MIRT2025134	hsa-miR-4722-3p	CLIP-seq
MIRT2557933	hsa-miR-4724-5p	CLIP-seq
MIRT2557934	hsa-miR-4726-3p	CLIP-seq
MIRT2557935	hsa-miR-4731-5p	CLIP-seq
MIRT2557936	hsa-miR-4735-5p	CLIP-seq
MIRT2557937	hsa-miR-4741	CLIP-seq
MIRT2557938	hsa-miR-4762-5p	CLIP-seq
MIRT1093681	hsa-miR-4772-3p	CLIP-seq
MIRT2256388	hsa-miR-4775	CLIP-seq
MIRT2025138	hsa-miR-4779	CLIP-seq
MIRT2557939	hsa-miR-4786-5p	CLIP-seq
MIRT2557940	hsa-miR-4792	CLIP-seq
MIRT1093683	hsa-miR-4794	CLIP-seq
MIRT1093685	hsa-miR-483-3p	CLIP-seq
MIRT1093686	hsa-miR-483-5p	CLIP-seq
MIRT2452592	hsa-miR-484	CLIP-seq
MIRT2557941	hsa-miR-491-5p	CLIP-seq
MIRT2025139	hsa-miR-498	CLIP-seq
MIRT2557942	hsa-miR-499a-5p	CLIP-seq
MIRT1093776	hsa-miR-509-3-5p	CLIP-seq
MIRT1093777	hsa-miR-509-5p	CLIP-seq
MIRT1093703	hsa-miR-556-5p	CLIP-seq
MIRT2557943	hsa-miR-570	CLIP-seq
MIRT2557944	hsa-miR-587	CLIP-seq
MIRT2256389	hsa-miR-590-3p	CLIP-seq
MIRT2025149	hsa-miR-642a	CLIP-seq
MIRT2557945	hsa-miR-646	CLIP-seq
MIRT1093782	hsa-miR-665	CLIP-seq
MIRT2557946	hsa-miR-762	CLIP-seq
MIRT2557947	hsa-miR-876-3p	CLIP-seq
MIRT2557948	hsa-miR-96	CLIP-seq
MIRT1093757	hsa-miR-4252	CLIP-seq
MIRT2683432	hsa-miR-10a	CLIP-seq
MIRT2683433	hsa-miR-10b	CLIP-seq
MIRT1093719	hsa-miR-1184	CLIP-seq
MIRT1093720	hsa-miR-1227	CLIP-seq
MIRT2256390	hsa-miR-1273	CLIP-seq
MIRT1093722	hsa-miR-1273e	CLIP-seq
MIRT1093723	hsa-miR-127-5p	CLIP-seq
MIRT1093725	hsa-miR-1297	CLIP-seq
MIRT1093726	hsa-miR-181a	CLIP-seq
MIRT1093727	hsa-miR-181b	CLIP-seq
MIRT1093728	hsa-miR-181c	CLIP-seq
MIRT1093729	hsa-miR-181d	CLIP-seq
MIRT1093730	hsa-miR-183	CLIP-seq
MIRT1093605	hsa-miR-216a	CLIP-seq
MIRT1093732	hsa-miR-216b	CLIP-seq
MIRT1093733	hsa-miR-219-5p	CLIP-seq
MIRT1093734	hsa-miR-2467-3p	CLIP-seq
MIRT1093735	hsa-miR-26a	CLIP-seq
MIRT1093736	hsa-miR-26b	CLIP-seq
MIRT1093737	hsa-miR-2964a-3p	CLIP-seq
MIRT1093738	hsa-miR-302f	CLIP-seq
MIRT1093739	hsa-miR-3065-3p	CLIP-seq
MIRT1093741	hsa-miR-3122	CLIP-seq
MIRT1093623	hsa-miR-3160-3p	CLIP-seq
MIRT2557908	hsa-miR-339-5p	CLIP-seq
MIRT1093745	hsa-miR-3612	CLIP-seq
MIRT1093748	hsa-miR-3665	CLIP-seq
MIRT1093749	hsa-miR-3689a-3p	CLIP-seq
MIRT1093750	hsa-miR-3689c	CLIP-seq
MIRT1093751	hsa-miR-3714	CLIP-seq
MIRT1093755	hsa-miR-3913-5p	CLIP-seq
MIRT1093757	hsa-miR-4252	CLIP-seq
MIRT1093648	hsa-miR-4257	CLIP-seq
MIRT1093758	hsa-miR-4262	CLIP-seq
MIRT2683434	hsa-miR-4293	CLIP-seq
MIRT1093761	hsa-miR-4418	CLIP-seq
MIRT2683435	hsa-miR-4421	CLIP-seq
MIRT1093762	hsa-miR-4459	CLIP-seq
MIRT1093763	hsa-miR-4465	CLIP-seq
MIRT2256396	hsa-miR-4486	CLIP-seq
MIRT1093662	hsa-miR-4487	CLIP-seq
MIRT2683436	hsa-miR-4645-5p	CLIP-seq
MIRT2256399	hsa-miR-4649-5p	CLIP-seq
MIRT2683437	hsa-miR-4662a-5p	CLIP-seq
MIRT2683438	hsa-miR-4673	CLIP-seq
MIRT2683439	hsa-miR-4676-5p	CLIP-seq
MIRT2683440	hsa-miR-4684-5p	CLIP-seq
MIRT1093766	hsa-miR-4695-5p	CLIP-seq
MIRT1093767	hsa-miR-4728-5p	CLIP-seq
MIRT1093769	hsa-miR-4736	CLIP-seq
MIRT1093771	hsa-miR-4768-3p	CLIP-seq
MIRT1093773	hsa-miR-4782-3p	CLIP-seq
MIRT2557939	hsa-miR-4786-5p	CLIP-seq
MIRT1093774	hsa-miR-4793-3p	CLIP-seq
MIRT1093776	hsa-miR-509-3-5p	CLIP-seq
MIRT1093777	hsa-miR-509-5p	CLIP-seq
MIRT2683441	hsa-miR-548c-3p	CLIP-seq
MIRT1093704	hsa-miR-558	CLIP-seq
MIRT2683442	hsa-miR-575	CLIP-seq
MIRT2683443	hsa-miR-593	CLIP-seq
MIRT1093780	hsa-miR-650	CLIP-seq
MIRT1093710	hsa-miR-661	CLIP-seq
MIRT1093782	hsa-miR-665	CLIP-seq
MIRT1093784	hsa-miR-940	CLIP-seq

Show/Hide all (44)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003774	Function	Cytoskeletal motor activity	IEA
GO:0003777	Function	Microtubule motor activity	IEA
GO:0005515	Function	Protein binding	IPI	12097473, 16225668, 20852589, 25416956, 32814053, 35271311, 36931259
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA	16225668
GO:0005739	Component	Mitochondrion	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005871	Component	Kinesin complex	IBA
GO:0005874	Component	Microtubule	IBA
GO:0005874	Component	Microtubule	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007018	Process	Microtubule-based movement	IEA
GO:0007270	Process	Neuron-neuron synaptic transmission	ISS
GO:0007274	Process	Neuromuscular synaptic transmission	ISS
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IEA
GO:0008574	Function	Plus-end-directed microtubule motor activity	IBA
GO:0008574	Function	Plus-end-directed microtubule motor activity	IDA	16225668
GO:0010970	Process	Transport along microtubule	IEA
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	IBA
GO:0016853	Function	Isomerase activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IBA
GO:0019894	Function	Kinesin binding	TAS	10341097
GO:0030424	Component	Axon	IBA
GO:0030425	Component	Dendrite	IBA
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0030672	Component	Synaptic vesicle membrane	ISS
GO:0031410	Component	Cytoplasmic vesicle	IBA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031410	Component	Cytoplasmic vesicle	ISS
GO:0043005	Component	Neuron projection	ISS
GO:0045202	Component	Synapse	IEA
GO:0047497	Process	Mitochondrion transport along microtubule	IEA
GO:0047497	Process	Mitochondrion transport along microtubule	IMP	16225668
GO:0048490	Process	Anterograde synaptic vesicle transport	ISS
GO:0098793	Component	Presynapse	IEA
GO:0098794	Component	Postsynapse	IEA
GO:1902742	Process	Apoptotic process involved in development	IMP	18334619
GO:1904115	Component	Axon cytoplasm	IEA
GO:1990049	Process	Retrograde neuronal dense core vesicle transport	IBA

MIM	HGNC	e!Ensembl
605995	16636	ENSG00000054523

O60333

Protein name

Kinesin-like protein KIF1B (Klp) (EC 5.6.1.3)

Protein function

Has a plus-end-directed microtubule motor activity and functions as a motor for transport of vesicles and organelles along microtubules. ; [Isoform 2]: Has a plus-end-directed microtubule motor activity an

PDB

2EH0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00225	Kinesin	11 → 354	Kinesin motor domain	Domain
PF16183	Kinesin_assoc	358 → 555	Kinesin-associated	Family
PF00498	FHA	556 → 627	FHA domain	Family
PF12423	KIF1B	845 → 892	Kinesin protein 1B	Family
PF12473	DUF3694	1266 → 1413	Kinesin protein	Family
PF00169	PH	1702 → 1799	PH domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 3 is abundant in the skeletal muscle. It is also expressed in fetal brain, lung and kidney, and adult heart, placenta, testis, ovary and small intestine. Isoform 2 is abundant in the brain and also expressed in fetal heart, lun

Sequence

MSGASVKVAVRVRPFNSRETSKESKCIIQMQGNSTSIINPKNPKEAPKSFSFDYSYWSHT
SPEDPCFASQNRVYNDIGKEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQEESQAGIIP
QLCEELFEKINDNCNEEMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVED
LSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQKKHDNETNLSTEK
VSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVDNCTSKSKKKKK
TDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIKCNAVI
NEDPNAKLVRELKEEVTRLKDLLRAQGLGDIIDIDPLIDDYSGSGSKYLKDFQNNKHRYL
LASENQRPGHFSTASMGSLTSSPSSCSLSSQVGLTSVTSIQERIMSTPGGEEAIERLKES
EKIIAELNETWEEKLRKTEAIRMEREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNED
PLMSECLLYYIKDGITRVGQADAERRQDIVLSGAHIKEEHCIFRSERSNSGEVIVTLEPC
ERSETYVNGKRVSQPVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPSEPVDWT
FAQRELLEKQGIDMKQEMEKRLQEMEILYKKEKEEADLLLEQQRLDYESKLQALQKQVET
RSLAAETTEEEEEEEEVPWTQHEFELAQWAFRKWKSHQFTSLRDLLWGNAVYLKEANAIS
VELKKKVQFQFVLLTDTLYSPLPPELLPTEMEKTHEDRPFPRTVVAVEVQDLKNGATHYW
SLEKLKQRLDLMREMYDRAGEMASSAQDESETTVTGSDPFYDRFHWFKLVGSSPIFHGCV
NERLADRTPSPTFSTADSDITELADEQQDEMEDFDDEAFVDDAGSDAGTEEGSDLFSDGH
DPFYDRSPWFILVGRAFVYLSNLLYPVPLIHRVAIVSEKGEVRGFLRVAVQAIAADEEAP
DYGSGIRQSGTAKISFDNEYFNQSDFSSVAMTRSGLSLEELRIVEGQGQSSEVITPPEEI
SRINDLDLKSSTLLDGKMVMEGFSEEIGNHLKLGSAFTFRVTVLQASGILPEYADIFCQF
NFLHRHDEAFSTEPLKNNGRGSPLAFYHVQNIAVEITESFVDYIKTKPIVFEVFGHYQQH
PLHLQGQELNSPPQPCRRFFPPPMPLSKPVPATKLNTMSKTSLGQSMSKYDLLVWFEISE
LEPTGEYIPAVVDHTAGLPCQGTFLLHQGIQRRITVTIIHEKGSELHWKDVRELVVGRIR
NKPEVDEAAVDAILSLNIISAKYLKSSHNSSRTFYRFEAVWDSSLHNSLLLNRVTPYGEK
IYMTLSAYLELDHCIQPAVITKDVCMVFYSRDAKISPPRSLRSLFGSGYSKSPDSNRVTG
IYELSLCKMSDTGSPGMQRRRRKILDTSVAYVRGEENLAGWRPRGDSLILEHQWELEKLE
LLHEVEKTRHFLLLRERLGDSIPKSLSDSLSPSLSSGTLSTSTSISSQISTTTFESAITP
SESSGYDSGDIESLVDREKELATKCLQLLTHTFNREFSQVHGSVSDCKLSDISPIGRDPS
ESSFSSATLTPSSTCPSLVDSRSNSLDQKTPEANSRASSPCPEFEQFQIVPAVETPYLAR
AGKNEFLNLVPDIEEIRPSSVVSKKGYLHFKEPLYSNWAKHFVVVRRPYVFIYNSDKDPV
ERGIINLSTAQVEYSEDQQAMVKTPNTFAVCTKHRGVLLQALNDKDMNDWLYAFNPLLAG
TIRSKLSRRCPSQSKY

Sequence length

1816

Interactions

View interactions

	KEGG		Reactome
	Motor proteins		COPI-dependent Golgi-to-ER retrograde traffic Kinesins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Charcot-Marie-Tooth disease type 2A1	Pathogenic	rs121908160	RCV000004921	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (65)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Adrenal pheochromocytoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Adult-onset proximal spinal muscular atrophy, autosomal dominant	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHROGRYPOSIS MULTIPLEX CONGENITA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL DOMINANT CHARCOT-MARIE-TOOTH DISEASE TYPE 2A1	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Charcot-Marie-Tooth disease	Benign; Conflicting classifications of pathogenicity; Likely benign; Uncertain significance	ClinVar ClinVar, Disgenet ClinVar, Disgenet ClinVar, Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Charcot-Marie-Tooth disease type 2	Uncertain significance; Conflicting classifications of pathogenicity; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Charcot-Marie-Tooth disease type 4	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
CHARCOT-MARIE-TOOTH DISEASE, AXONAL, TYPE 2A1	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Charcot-Marie-Tooth disease, type I	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEMIHYPERTROPHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL JOINT CONTRACTURES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEJERINE-SOTTAS DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Distal muscle weakness	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EEG abnormality	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EMG abnormality	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EMG: axonal abnormality	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EMG: myopathic abnormalities	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Exaggerated startle response	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gait ataxia	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma susceptibility 1	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Global developmental delay	Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Hepatocellular carcinoma	Benign	ClinVar GWAS catalog	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Hereditary cancer	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary cancer-predisposing syndrome	Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY MOTOR AND SENSORY NEUROPATHIES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY MOTOR AND SENSORY NEUROPATHY TYPE I	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY MOTOR AND SENSORY NEUROPATHY, TYPES I-IV	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY MOTOR AND SENSORY-NEUROPATHY TYPE II	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC NEUROPATHY OF INFANCY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual disability	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Joint laxity	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIF1B-related disorder	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUMINAL A BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUMINAL B BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of breast	Conflicting classifications of pathogenicity; Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meniere disease	Conflicting classifications of pathogenicity; Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Multiple endocrine neoplasia type 2A	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Benign; Conflicting classifications of pathogenicity; Likely benign; Uncertain significance	ClinVar CTD	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Neuroblastoma, susceptibility to, 1	Uncertain significance; Conflicting classifications of pathogenicity; risk factor; Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROBLASTOMA, SUSCEPTIBILITY TO, 1, INCLUDED	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Conflicting classifications of pathogenicity; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pain	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Palpitations	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERONEAL MUSCULAR ATROPHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pheochromocytoma	Uncertain significance; Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar CTD, ClinVar, GenCC CTD, ClinVar, GenCC CTD, ClinVar, GenCC	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Recurrent paroxysmal headache	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ROUSSY-LEVY SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS, UNSPECIFIED	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPINAL MUSCULAR ATROPHY, LATE-ONSET, FINKEL TYPE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vitiligo	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)

Show/Hide Text Mining Associations (151)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	18726616, 23061808, 24469107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	11231025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	34440432	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyloidosis	Amyloidosis	BEFREE	30286783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	20951041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Aniridia	Aniridia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal dominant Charcot-Marie-Tooth disease type 2A1	Charcot-Marie-Tooth Disease	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	30560509		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Capillary hemangioma of retina	Capillary Hemangioma Of Retina	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22363396, 22712471, 22807686, 24204805, 24357186, 26217094, 27122668	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	25854172	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26823729	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25854172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	19268652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Diseases	Cerebellar Diseases	BEFREE	30039206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	21258814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth Disease	Charcot-Marie-Tooth Disease	BEFREE	10219749, 10441578, 10716658, 10737979, 11003785, 11345007, 11528513, 11898586, 12402337, 12901697, 1341967, 14871449, 15021985, 15535039, 15549395 View all (65 more)		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Charcot-Marie-Tooth Disease	Charcot-Marie-Tooth Disease	CLINVAR_DG			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Charcot-Marie-Tooth Disease, Axonal, Type 2a1	Charcot-Marie-Tooth Disease	ORPHANET_DG	11389829		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Charcot-Marie-Tooth Disease, Axonal, Type 2a1	Charcot-Marie-Tooth Disease	UNIPROT_DG	11389829		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Charcot-Marie-Tooth Disease, Axonal, Type 2a1	Charcot-Marie-Tooth Disease	GENOMICS_ENGLAND_DG	25802885		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Charcot-Marie-Tooth Disease, Axonal, Type 2a1	Charcot-Marie-Tooth Disease	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Charcot-Marie-Tooth Disease, Axonal, Type 2a1	Charcot-Marie-Tooth Disease	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHARCOT-MARIE-TOOTH DISEASE, AXONAL, TYPE 2F	Charcot-Marie-Tooth Disease	BEFREE	11528513		★★★★★ ★☆☆☆☆ Found in Text Mining only
CHARCOT-MARIE-TOOTH DISEASE, AXONAL, TYPE 2L (disorder)	Charcot-Marie-Tooth Disease	BEFREE	15021985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth disease, Type 2B2	Charcot-Marie-Tooth disease	BEFREE	12481988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth disease, Type 2I	Charcot-Marie-Tooth disease	BEFREE	15021985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth Disease, Type Ia (disorder)	Charcot-Marie-Tooth disease	BEFREE	18602827, 29063243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	22363396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Compression of spinal cord	Spinal cord compression	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Conductive hearing loss	Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hypomyelinating neuropathy	Congenital Hypomyelinating Neuropathy	BEFREE	15094849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26823729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Dystrophy Crystalline of Schnyder	Corneal dystrophy	Pubtator	16163269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cranial nerve compression	Cranial nerve compression	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	20461396, 9187667, 9888385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Distal amyotrophy	Distal amyotrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Distal Spinal Muscular Atrophy	Distal Spinal Muscular Atrophy	BEFREE	10400924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Episodic paroxysmal anxiety	Episodic paroxysmal anxiety	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	25854172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Friedreich Ataxia	Friedreich Ataxia	BEFREE	19268652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ganglioneuroblastoma	Ganglioneuroblastoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ganglioneuroma	Ganglioneuroma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
GIANT AXONAL NEUROPATHY 1	Giant Axonal Neuropathy	BEFREE	24758703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	26576027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	26307494, 30039206		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Glomerulonephritis	Glomerulonephritis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	21623771, 22714410, 30737464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	22363396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	22363396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Autosomal Dominant Spastic Paraplegia	Spastic paraplegia	BEFREE	30583522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary liability to pressure palsies	Hereditary Liability To Pressure Palsies	BEFREE	25253751, 26454100, 9187667, 9888385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Motor and Sensory Neuropathies	Hereditary motor and sensory neuropathy	BEFREE	11231025, 1517763, 19344920		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary Motor and Sensory Neuropathy Type I	Hereditary motor and sensory neuropathy	BEFREE	1517763, 9888385		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary motor and sensory neuropathy with optic atrophy (disorder)	Hereditary Motor And Sensory Neuropathy With Optic Atrophy	BEFREE	16835246, 19268652		★★★★★ ★☆☆☆☆ Found in Text Mining only
HEREDITARY MOTOR AND SENSORY NEUROPATHY, TYPE IIC (disorder)	Hereditary motor and sensory neuropathy	BEFREE	31468327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Motor and Sensory-Neuropathy Type II	Dysautonomia	BEFREE	10520946, 1517763, 8406488, 9219740, 9409358, 9595994		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary Paraganglioma-Pheochromocytoma Syndrome	Hereditary Paraganglioma-Pheochromocytoma Syndromes	CLINGEN_DG	18334619, 18726616, 23010473, 24469107, 24694336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary pheochromocytoma-paraganglioma	Hereditary Pheochromocytoma-Paraganglioma	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Sensory Autonomic Neuropathy, Type 1	Hereditary sensory and autonomic neuropathy	BEFREE	11003785		★★★★★ ★☆☆☆☆ Found in Text Mining only
HMSN Type V	Charcot-Marie-Tooth disease	BEFREE	20660910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Horner Syndrome	Horner Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive Retinopathy	Hypertensive Retinopathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Inherited Peripheral Neuropathy	Inherited Peripheral Neuropathy	BEFREE	27506976, 27706887, 8406488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	11231025		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Liver carcinoma	Liver carcinoma	BEFREE	20676096, 22363396, 22712471, 22807686, 23028799, 23634229, 23803045, 24952890, 25153661, 26217094, 27122668, 29881295, 30073017, 30947687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	GWASCAT_DG	20676096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	GWASDB_DG	20676096, 23242368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	23028799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30560509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23354307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18726616, 20676096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	LHGDN	18334619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	11231025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	30039206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	20951041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASCAT_DG	18997785		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	CTD_human_DG	18997785		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	18997785		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	19503091, 19935835, 20067515, 21594895, 21680216, 24144874		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	19935835, 21594895, 23469041	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis, Acute Fulminating	Multiple Sclerosis	CTD_human_DG	18997785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy, Centronuclear, Autosomal Dominant	Myopathy	BEFREE	18394888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10762626, 11526494, 11779404, 15711769, 18726616, 24706657, 25518808, 30294913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	26956144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural crest tumor	Neural Crest Tumor	BEFREE	18726616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10762626, 11526494, 18726616, 24469107, 24706657, 8842741		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Neuroblastoma	Neuroblastoma	LHGDN	18334619, 18614535		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Neuroblastoma	Neuroblastoma	Pubtator	34116676	Associate	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Neuroblastoma	Neuroblastoma	CTD_human_DG			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Neuroblastoma	Neuroblastoma	HPO_DG			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	16468021, 23840650, 26168012, 31664033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular Diseases	BEFREE	31167812		★★★★★ ★☆☆☆☆ Found in Text Mining only
NEURONOPATHY, DISTAL HEREDITARY MOTOR, TYPE V	Neuronopathy	BEFREE	17663003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	11389829, 11528513, 14711881, 15021985, 18826755, 19344920, 19381883, 20537790, 20645406, 21902652, 22714410, 26423936, 26786738, 26989944, 29449460, 30286783, 7849745 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy ataxia and retinis pigmentosa	Neuropathy Ataxia And Retinis Pigmentosa	BEFREE	21402391		★★★★★ ★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	15711769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Opsoclonus	Opsoclonus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic Atrophy	BEFREE	19268652, 20951041, 26168012, 26686600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	16468021, 26168012		★★★★★ ★☆☆☆☆ Found in Text Mining only
OPTIC ATROPHY WITH OR WITHOUT DEAFNESS, OPHTHALMOPLEGIA, MYOPATHY, ATAXIA, AND NEUROPATHY	Optic Atrophy With Or Without Deafness, Ophthalmoplegia, Myopathy, Ataxia, And Neuropathy	BEFREE	19268652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy, Hereditary, Leber	Hereditary Leber Optic Atrophy	BEFREE	19268652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Neuropathy	Optic Neuropathy	BEFREE	29063243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Panic Attacks	Panic Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	Pubtator	33138083, 33397043, 37780619	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraganglioma of head and neck	Paraganglioma of head and neck	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal hypertension	Paroxysmal Hypertension	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Partial Paralysis (Paresis) Vocal Cords	Partial Paralysis Vocal Cords	BEFREE	21288981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral axonal atrophy	Peripheral axonal atrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral axonal neuropathy	Peripheral axonal neuropathy	BEFREE	26168012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral motor neuropathy	Motor nerve neuritis	BEFREE	18379723, 20350294, 25342199, 26989944, 28251916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	24758703, 24863639, 30659145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	24758703, 24863639, 30659145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peroneal muscle atrophy	Peroneal muscle atrophy	BEFREE	12901697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	LHGDN	18334619		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Pheochromocytoma	Pheochromocytoma	BEFREE	18726616, 24469107		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Pheochromocytoma	Pheochromocytoma	Pubtator	35046208	Associate	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Pheochromocytoma	Pheochromocytoma	CTD_human_DG			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Pheochromocytoma	Pheochromocytoma	HPO_DG			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Pheochromocytoma	Pheochromocytoma	GENOMICS_ENGLAND_DG			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Pheochromocytoma	Pheochromocytoma	CLINVAR_DG			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Pheochromocytoma, Extra-Adrenal	Extra-Adrenal Pheochromocytoma	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma, Extra-Adrenal	Extra-Adrenal Pheochromocytoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyneuropathy	Polyneuropathy	BEFREE	21402391, 26686600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary congenital glaucoma	Congenital glaucoma	BEFREE	8842741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulsatile Tinnitus	Pulsatile Tinnitus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Artery Stenosis	Renal Artery Stenosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26823729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Russell-Silver syndrome	Russell-Silver Syndrome	BEFREE	17663003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensory neuropathy	Sensory neuropathy	BEFREE	24804794, 26307494, 26686600, 30011089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sinus Tachycardia	Sinus Tachycardia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia	Spastic Paraplegia	BEFREE	26686600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic paraplegia 10, autosomal dominant	Spondylometaphyseal dysplasia	BEFREE	21623771, 29566793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic paraplegia 17	Spastic Paraplegia	BEFREE	17663003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia, Hereditary	Spastic paraplegia	BEFREE	22714410, 29566793, 30737464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	21902652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23354307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Syndactyly, type 2	Syndactyly	BEFREE	28910277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vocal Cord Paralysis	Vocal Cord Paralysis	BEFREE	31468327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vocal Cord Paralysis	Vocal Cord Paralysis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	15711769		★★★★★ ★☆☆☆☆ Found in Text Mining only

KIF1B (kinesin family member 1B)