Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	23082
Gene name	PPARG related coactivator 1
Gene symbol	PPRC1
Synonyms (NCBI Gene)	PRC
Chromosome	10
Chromosome location	10q24.32
Summary	The protein encoded by this gene is similar to PPAR-gamma coactivator 1 (PPARGC1/PGC-1), a protein that can activate mitochondrial biogenesis in part through a direct interaction with nuclear respiratory factor 1 (NRF1). This protein has been shown to int

Show/Hide all (78)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022950	hsa-miR-124-3p	Microarray	18668037
MIRT025837	hsa-miR-7-5p	Microarray	19073608
MIRT027703	hsa-miR-98-5p	Microarray	19088304
MIRT051899	hsa-let-7b-5p	CLASH	23622248
MIRT047060	hsa-miR-183-5p	CLASH	23622248
MIRT046595	hsa-miR-222-3p	CLASH	23622248
MIRT046595	hsa-miR-222-3p	CLASH	23622248
MIRT045265	hsa-miR-186-5p	CLASH	23622248
MIRT039315	hsa-miR-425-5p	CLASH	23622248
MIRT038413	hsa-miR-296-3p	CLASH	23622248
MIRT1259131	hsa-miR-132	CLIP-seq
MIRT1259132	hsa-miR-15a	CLIP-seq
MIRT1259133	hsa-miR-15b	CLIP-seq
MIRT1259134	hsa-miR-16	CLIP-seq
MIRT1259135	hsa-miR-195	CLIP-seq
MIRT1259136	hsa-miR-212	CLIP-seq
MIRT1259137	hsa-miR-3136-3p	CLIP-seq
MIRT1259138	hsa-miR-3147	CLIP-seq
MIRT1259139	hsa-miR-3163	CLIP-seq
MIRT1259140	hsa-miR-3179	CLIP-seq
MIRT1259141	hsa-miR-3202	CLIP-seq
MIRT1259142	hsa-miR-340	CLIP-seq
MIRT1259143	hsa-miR-424	CLIP-seq
MIRT1259144	hsa-miR-4271	CLIP-seq
MIRT1259145	hsa-miR-4428	CLIP-seq
MIRT1259146	hsa-miR-4524	CLIP-seq
MIRT1259147	hsa-miR-4651	CLIP-seq
MIRT1259148	hsa-miR-4660	CLIP-seq
MIRT1259149	hsa-miR-4690-5p	CLIP-seq
MIRT1259150	hsa-miR-4725-3p	CLIP-seq
MIRT1259151	hsa-miR-4747-5p	CLIP-seq
MIRT1259152	hsa-miR-497	CLIP-seq
MIRT1259153	hsa-miR-503	CLIP-seq
MIRT1259154	hsa-miR-587	CLIP-seq
MIRT1259155	hsa-miR-608	CLIP-seq
MIRT1259156	hsa-miR-646	CLIP-seq
MIRT1259157	hsa-miR-765	CLIP-seq
MIRT1259131	hsa-miR-132	CLIP-seq
MIRT2076381	hsa-miR-153	CLIP-seq
MIRT1259132	hsa-miR-15a	CLIP-seq
MIRT1259133	hsa-miR-15b	CLIP-seq
MIRT1259134	hsa-miR-16	CLIP-seq
MIRT1259135	hsa-miR-195	CLIP-seq
MIRT1259136	hsa-miR-212	CLIP-seq
MIRT1259138	hsa-miR-3147	CLIP-seq
MIRT1259139	hsa-miR-3163	CLIP-seq
MIRT1259140	hsa-miR-3179	CLIP-seq
MIRT1259141	hsa-miR-3202	CLIP-seq
MIRT1259142	hsa-miR-340	CLIP-seq
MIRT1259143	hsa-miR-424	CLIP-seq
MIRT1259144	hsa-miR-4271	CLIP-seq
MIRT1259145	hsa-miR-4428	CLIP-seq
MIRT2076382	hsa-miR-4474-5p	CLIP-seq
MIRT1259146	hsa-miR-4524	CLIP-seq
MIRT1259147	hsa-miR-4651	CLIP-seq
MIRT1259148	hsa-miR-4660	CLIP-seq
MIRT1259150	hsa-miR-4725-3p	CLIP-seq
MIRT1259151	hsa-miR-4747-5p	CLIP-seq
MIRT1259152	hsa-miR-497	CLIP-seq
MIRT1259153	hsa-miR-503	CLIP-seq
MIRT1259154	hsa-miR-587	CLIP-seq
MIRT1259155	hsa-miR-608	CLIP-seq
MIRT1259156	hsa-miR-646	CLIP-seq
MIRT1259157	hsa-miR-765	CLIP-seq
MIRT1259131	hsa-miR-132	CLIP-seq
MIRT1259132	hsa-miR-15a	CLIP-seq
MIRT1259133	hsa-miR-15b	CLIP-seq
MIRT1259134	hsa-miR-16	CLIP-seq
MIRT1259135	hsa-miR-195	CLIP-seq
MIRT1259136	hsa-miR-212	CLIP-seq
MIRT1259139	hsa-miR-3163	CLIP-seq
MIRT1259142	hsa-miR-340	CLIP-seq
MIRT1259143	hsa-miR-424	CLIP-seq
MIRT1259146	hsa-miR-4524	CLIP-seq
MIRT1259148	hsa-miR-4660	CLIP-seq
MIRT1259152	hsa-miR-497	CLIP-seq
MIRT1259153	hsa-miR-503	CLIP-seq
MIRT1259156	hsa-miR-646	CLIP-seq

Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003712	Function	Transcription coregulator activity	IEA
GO:0003713	Function	Transcription coactivator activity	IBA
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003723	Function	RNA binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0097009	Process	Energy homeostasis	IBA

MIM	HGNC	e!Ensembl
617462	30025	ENSG00000148840

Q5VV67

Protein name

Peroxisome proliferator-activated receptor gamma coactivator-related protein 1 (PGC-1-related coactivator) (PRC)

Protein function

Acts as a coactivator during transcriptional activation of nuclear genes related to mitochondrial biogenesis and cell growth. Involved in the transcription coactivation of CREB and NRF1 target genes. {ECO:0000269|PubMed:11340167, ECO:0000269|Pub

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00076	RRM_1	1545 → 1608	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain

Tissue specificity

TISSUE SPECIFICITY: Strongly expressed in heart and skeletal muscle, moderately in lung, placenta, intestine, liver, kidney, spleen, thymus, colon and brain. Also expressed in several oncocytic thyroid tumors. {ECO:0000269|PubMed:11340167, ECO:0000269|Pub

Sequence

MAARRGRRDGVAPPPSGGPGPDPGGGARGSGWGSRSQAPYGTLGAVSGGEQVLLHEEAGD
SGFVSLSRLGPSLRDKDLEMEELMLQDETLLGTMQSYMDASLISLIEDFGSLGESRLSLE
DQNEVSLLTALTEILDNADSENLSPFDSIPDSELLVSPREGSSLHKLLTLSRTPPERDLI
TPVDPLGPSTGSSRGSGVEMSLPDPSWDFSPPSFLETSSPKLPSWRPPRSRPRWGQSPPP
QQRSDGEEEEEVASFSGQILAGELDNCVSSIPDFPMHLACPEEEDKATAAEMAVPAAGDE
SISSLSELVRAMHPYCLPNLTHLASLEDELQEQPDDLTLPEGCVVLEIVGQAATAGDDLE
IPVVVRQVSPGPRPVLLDDSLETSSALQLLMPTLESETEAAVPKVTLCSEKEGLSLNSEE
KLDSACLLKPREVVEPVVPKEPQNPPANAAPGSQRARKGRKKKSKEQPAACVEGYARRLR
SSSRGQSTVGTEVTSQVDNLQKQPQEELQKESGPLQGKGKPRAWARAWAAALENSSPKNL
ERSAGQSSPAKEGPLDLYPKLADTIQTNPIPTHLSLVDSAQASPMPVDSVEADPTAVGPV
LAGPVPVDPGLVDLASTSSELVEPLPAEPVLINPVLADSAAVDPAVVPISDNLPPVDAVP
SGPAPVDLALVDPVPNDLTPVDPVLVKSRPTDPRRGAVSSALGGSAPQLLVESESLDPPK
TIIPEVKEVVDSLKIESGTSATTHEARPRPLSLSEYRRRRQQRQAETEERSPQPPTGKWP
SLPETPTGLADIPCLVIPPAPAKKTALQRSPETPLEICLVPVGPSPASPSPEPPVSKPVA
SSPTEQVPSQEMPLLARPSPPVQSVSPAVPTPPSMSAALPFPAGGLGMPPSLPPPPLQPP
SLPLSMGPVLPDPFTHYAPLPSWPCYPHVSPSGYPCLPPPPTVPLVSGTPGAYAVPPTCS
VPWAPPPAPVSPYSSTCTYGPLGWGPGPQHAPFWSTVPPPPLPPASIGRAVPQPKMESRG
TPAGPPENVLPLSMAPPLSLGLPGHGAPQTEPTKVEVKPVPASPHPKHKVSALVQSPQMK
ALACVSAEGVTVEEPASERLKPETQETRPREKPPLPATKAVPTPRQSTVPKLPAVHPARL
RKLSFLPTPRTQGSEDVVQAFISEIGIEASDLSSLLEQFEKSEAKKECPPPAPADSLAVG
NSGGVDIPQEKRPLDRLQAPELANVAGLTPPATPPHQLWKPLAAVSLLAKAKSPKSTAQE
GTLKPEGVTEAKHPAAVRLQEGVHGPSRVHVGSGDHDYCVRSRTPPKKMPALVIPEVGSR
WNVKRHQDITIKPVLSLGPAAPPPPCIAASREPLDHRTSSEQADPSAPCLAPSSLLSPEA
SPCRNDMNTRTPPEPSAKQRSMRCYRKACRSASPSSQGWQGRRGRNSRSVSSGSNRTSEA
SSSSSSSSSSSRSRSRSLSPPHKRWRRSSCSSSGRSRRCSSSSSSSSSSSSSSSSSSSSR
SRSRSPSPRRRSDRRRRYSSYRSHDHYQRQRVLQKERAIEERRVVFIGKIPGRMTRSELK
QRFSVFGEIEECTIHFRVQGDNYGFVTYRYAEEAFAAIESGHKLRQADEQPFDLCFGGRR
QFCKRSYSDLDSNREDFDPAPVKSKFDSLDFDTLLKQAQKNLRR

Sequence length

1664

Interactions

View interactions

	Reactome
			Transcriptional activation of mitochondrial biogenesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PPRC1-related conditon	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PPRC1-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (32)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinogenesis	Carcinogenesis	Pubtator	26337274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37109742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28606125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	27216214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17341490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28099397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	18048499	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	29415665		★★★★★ ★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	26337274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	19036724	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	31701363, 31773814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28606125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21840484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21937425, 28758948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28099397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	22028491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	18332166, 19036724, 19956726, 21937425, 27789709	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Respiratory Chain Deficiencies	Mitochondrial Respiratory Chain Deficiencies	BEFREE	19036724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	1673293, 28758948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	28984200	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	21937425	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29415665		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28606125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	37109742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oxyphilic Adenoma	Oxyphilic Adenoma	LHGDN	14550271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	21840484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21840484, 22644296	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	29415665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	29415665	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	29415665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	29662614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	31640555		★★★★★ ★☆☆☆☆ Found in Text Mining only

PPRC1 (PPARG related coactivator 1)