CAND2 (cullin associated and neddylation dissociated 2 (putative))

Gene

• Entrez ID: 23066
• Gene name: Cullin associated and neddylation dissociated 2 (putative)
• Gene symbol: CAND2
• Synonyms (NCBI Gene): TIP120B, Tp120b
• Chromosome: 3
• Chromosome location: 3p25.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT052532	hsa-let-7a-5p	CLASH	23622248
MIRT861224	hsa-miR-1252	CLIP-seq
MIRT861225	hsa-miR-1273d	CLIP-seq
MIRT861226	hsa-miR-145	CLIP-seq
MIRT861227	hsa-miR-198	CLIP-seq
MIRT861228	hsa-miR-2861	CLIP-seq
MIRT861229	hsa-miR-3162-3p	CLIP-seq
MIRT861230	hsa-miR-3914	CLIP-seq
MIRT861231	hsa-miR-4252	CLIP-seq
MIRT861232	hsa-miR-4722-3p	CLIP-seq
MIRT861233	hsa-miR-4763-5p	CLIP-seq
MIRT861234	hsa-miR-635	CLIP-seq
MIRT861235	hsa-miR-643	CLIP-seq
MIRT861236	hsa-miR-660	CLIP-seq
MIRT861237	hsa-miR-890	CLIP-seq
MIRT861226	hsa-miR-145	CLIP-seq
MIRT861227	hsa-miR-198	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	12207886, 12692129, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005829	Component	Cytosol	IDA	12692129
GO:0010265	Process	SCF complex assembly	IBA
GO:0010265	Process	SCF complex assembly	IEA
GO:0016567	Process	Protein ubiquitination	IBA
GO:0017025	Function	TBP-class protein binding	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS

Other IDs

• MIM: 610403
• HGNC: 30689
• e!Ensembl: ENSG00000144712

Protein

• UniProt ID: O75155
• Protein name: Cullin-associated NEDD8-dissociated protein 2 (Cullin-associated and neddylation-dissociated protein 2) (Epididymis tissue protein Li 169) (TBP-interacting protein of 120 kDa B) (TBP-interacting protein 120B) (p120 CAND2)
• Protein function: Probable assembly factor of SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complexes that promotes the exchange of the substrate-recognition F-box subunit in SCF complexes, thereby playing a key role in the cellular repertoire of SCF complexe
• PDB: 8VVY
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08623	TIP120	1045 → 1208	TATA-binding protein interacting (TIP20)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in epididymis (at protein level). {ECO:0000269|PubMed:20736409}.
• Sequence:

  MSTAAFHISSLLEKMTSSDKDFRFMATSDLMSELQKDSIQLDEDSERKVVKMLLRLLEDK
  NGEVQNLAVKCLGPLVVKVKEYQVETIVDTLCTNMRSDKEQLRDIAGIGLKTVLSELPPA
  ATGSGLATNVCRKITGQLTSAIAQQEDVAVQLEALDILSDMLSRLGVPLGAFHASLLHCL
  LPQLSSPRLAVRKRAVGALGHLAAACSTDLFVELADHLLDRLPGPRVPTSPTAIRTLIQC
  LGSVGRQAGHRLGAHLDRLVPLVEDFCNLDDDELRESCLQAFEAFLRKCPKEMGPHVPNV
  TSLCLQYIKHDPNYNYDSDEDEEQMETEDSEFSEQESEDEYSDDDDMSWKVRRAAAKCIA
  ALISSRPDLLPDFHCTLAPVLIRRFKEREENVKADVFTAYIVLLRQTQPPKGWLEAMEEP
  TQTGSNLHMLRGQVPLVVKALQRQLKDRSVRARQGCFSLLTELAGVLPGSLAEHMPVLVS
  GIIFSLADRSSSSTIRMDALAFLQGLLGTEPAEAFHPHLPILLPPVMACVADSFYKIAAE
  ALVVLQELVRALWPLHRPRMLDPEPYVGEMSAVTLARLRATDLDQEVKERAISCMGHLVG
  HLGDRLGDDLEPTLLLLLDRLRNEITRLPAIKALTLVAVSPLQLDLQPILAEALHILASF
  LRKNQRALRLATLAALDALAQSQGLSLPPSAVQAVLAELPALVNESDMHVAQLAVDFLAT
  VTQAQPASLVEVSGPVLSELLRLLRSPLLPAGVLAAAEGFLQALVGTRPPCVDYAKLISL
  LTAPVYEQAVDGGPGLHKQVFHSLARCVAALSAACPQEAASTASRLVCDARSPHSSTGVK
  VLAFLSLAEVGQVAGPGHQRELKAVLLEALGSPSEDVRAAASYALGRVGAGSLPDFLPFL
  LEQIEAEPRRQYLLLHSLREALGAAQPDSLKPYAEDIWALLFQRCEGAEEGTRGVVAECI
  GKLVLVNPSFLLPRLRKQLAAGRPHTRSTVITAVKFLISDQPHPIDPLLKSFIGEFMESL
  QDPDLNVRRATLAFFNSAVHNKPSLVRDLLDDILPLLYQETKIRRDLIREVEMGPFKHTV
  DDGLDVRKAAFECMYSLLESCLGQLDICEFLNHVEDGLKDHYDIRMLTFIMVARLATLCP
  APVLQRVDRLIEPLRATCTAKVKAGSVKQEFEKQDELKRSAMRAVAALLTIPEVGKSPIM
  ADFSSQIRSNPELAALFESIQKDSASAPSTDSMELS

• Sequence length: 1236

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATRIAL FIBRILLATION	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FLUTTER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIAC ARRHYTHMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Atrial Fibrillation	Atrial Fibrillation	BEFREE	27203392, 29459676		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial fibrillation	Pubtator	27203392, 29459676	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	CTD_human_DG	29892015, 30061737		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	29892015, 30061737		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bicuspid Aortic Valve Disease	Bicuspid aortic valve	Pubtator	36071494	Associate	★☆☆☆☆ Found in Text Mining only
Congenital clubfoot	Congenital Clubfoot	BEFREE	19159115		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31554135		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26491211		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31554135		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29717274		★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	CTD_human_DG	29892015, 30061737		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26491211		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26491211	Associate	★☆☆☆☆ Found in Text Mining only
SIMPSON-GOLABI-BEHMEL SYNDROME, TYPE 1	Simpson-Golabi-Behmel Syndrome	BEFREE	29717274		★☆☆☆☆ Found in Text Mining only